Align Tryptophan 2,3-dioxygenase; TDO; Tryptamin 2,3-dioxygenase; Tryptophan oxygenase; TO; TRPO; Tryptophan pyrrolase; Tryptophanase; EC 1.13.11.11 (characterized)
to candidate N515DRAFT_0357 N515DRAFT_0357 tryptophan 2,3-dioxygenase
Query= SwissProt::Q8PDA8 (298 letters) >FitnessBrowser__Dyella79:N515DRAFT_0357 Length = 282 Score = 405 bits (1041), Expect = e-118 Identities = 197/278 (70%), Positives = 225/278 (80%) Query: 6 NLRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEMLFIIQHQTSELWLKLL 65 N RDLE GI DL+GRLTYGGYLRLD LLSAQQPLS+P HHDEMLFI+QHQ +ELW+KL+ Sbjct: 4 NRRDLEAGIEVDLQGRLTYGGYLRLDALLSAQQPLSQPPHHDEMLFIVQHQVAELWMKLI 63 Query: 66 AHELRAAIVHLQRDEVWQCRKVLARSKQVLRQLTEQWSVLETLTPSEYMGFRDVLGPSSG 125 HEL+AAI HL RD++ C K+LAR K V RQL EQW VLETLTP+EY+ FRD+LG SSG Sbjct: 64 IHELKAAIEHLHRDDIDPCLKILARVKHVQRQLYEQWGVLETLTPAEYLEFRDILGSSSG 123 Query: 126 FQSLQYRYIEFLLGNKNPQMLQVFAYDPAGQARLREVLEAPSLYEEFLRYLARFGHAIPQ 185 FQSLQYR IEFLLGNKN QML VFAYDPA QA LREVLEAPSLY+EFL YLAR GHA+P Sbjct: 124 FQSLQYRQIEFLLGNKNEQMLAVFAYDPAAQAALREVLEAPSLYDEFLAYLARRGHAVPA 183 Query: 186 QYQARDWTAAHVADDTLRPVFERIYENTDRYWREYSLCEDLVDVETQFQLWRFRHMRTVM 245 + RDWT + ++ L PV +RIYEN +W EY +CE LVDVE QFQ WRFRHM+TV Sbjct: 184 ELLGRDWTQPYQRNEGLLPVLKRIYENRAEHWPEYYMCEQLVDVEGQFQQWRFRHMKTVE 243 Query: 246 RVIGFKRGTGGSSGVGFLQQALALTFFPELFDVRTSVG 283 R+IG +RGTGGSSGV FL++AL L FFPEL DVRT +G Sbjct: 244 RIIGHRRGTGGSSGVAFLKKALELEFFPELLDVRTVLG 281 Lambda K H 0.323 0.138 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 348 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 282 Length adjustment: 26 Effective length of query: 272 Effective length of database: 256 Effective search space: 69632 Effective search space used: 69632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory