Align 2-amino-5-chloromuconic acid deaminase; 2-aminomuconate deaminase; EC 3.5.99.5 (characterized)
to candidate N515DRAFT_4323 N515DRAFT_4323 aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A (EC 6.3.5.-)
Query= SwissProt::Q38M35 (462 letters) >FitnessBrowser__Dyella79:N515DRAFT_4323 Length = 469 Score = 147 bits (371), Expect = 7e-40 Identities = 133/424 (31%), Positives = 191/424 (45%), Gaps = 35/424 (8%) Query: 35 RMEPRLNAYKTWDGARARSAAAAVDTLLDQGQDLGPLMGLPVSVKDLYGVPGLPVFAGSD 94 R+ P+LNAY R A A G LG L GLPV++KD + V G P AG Sbjct: 44 RLNPQLNAYVGLSAGLLREQARAAQHRRRDGV-LGRLDGLPVAIKDNFDVAGWPTRAGLP 102 Query: 95 EALPEAWQAAGPLVARLQRQLGIVVGKTHTVEFAFGGLGVNAHWGTPRNPWSPHEHR-VP 153 A Q VARL+ +++GKT+ E A G N H G NP H H Sbjct: 103 GRAQPA-QGDAHAVARLRASGAVLLGKTNMDEGALGASTDNPHTGPTHNP---HRHGYTA 158 Query: 154 GGSSAGAGVSLVQGSALLALGTDTAGSVRVPASMTGQVGLKTTVGRWPVEGIVPLSSSLD 213 GGSS GA ++ G A+ A+G+D+ GS+R+PAS G LK T G G+VP + LD Sbjct: 159 GGSSGGAAAAVAAGMAVAAIGSDSLGSIRIPASYCGVYALKPTHGEISARGLVPAARRLD 218 Query: 214 TAGVLTRTVEDLAYAFAAL------DTESQGLP---APAPVRVQGLRVGVPTNHFWDDID 264 G+L R+ DL L D S+ AP LR G+ + ++ Sbjct: 219 AVGLLARSANDLTVLLQVLAGYDADDARSRRRRVAFAPPDWEPGNLRCGLLPDLAAVGVE 278 Query: 265 PSIAAAVEAAVQRLAQAGAQVVRFPLPHCEEAFDIFRRGGL------AASELAAYLDQHF 318 ++ E A+ RL + + R + + F RR GL S AA LD Sbjct: 279 AAVIDVFEDALSRLPRELGE--RRQVDFSDWDFARTRRAGLFLMEAEMLSTFAADLDDAE 336 Query: 319 PHKVERLDPVVRDRVRWAEQVSSVEYLRRKAVLQRCGAGAARLFDDVDVLLTPTVPASPP 378 ER R + +A S+ +Y VL RLF +DVL+ PT P Sbjct: 337 HPASERF----RRMLSYAATKSAADYAVADRVLDAATLKMRRLFAQIDVLVLPTTPQG-- 390 Query: 379 RLADIGTVETYAPANMKAMRNTAISNLFGWCALTMPVGLDANRMPVGLQLMGPPRAEARL 438 +G + A++ T+ ++L G A+++P+G + MPVG+QL+G ++ RL Sbjct: 391 -AFPLGGAVPDSQADL-----TSFASLAGCPAVSIPMGTLPDGMPVGMQLVGARGSDLRL 444 Query: 439 IGIA 442 + +A Sbjct: 445 LELA 448 Lambda K H 0.320 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 35 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 462 Length of database: 469 Length adjustment: 33 Effective length of query: 429 Effective length of database: 436 Effective search space: 187044 Effective search space used: 187044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory