Align 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (characterized)
to candidate N515DRAFT_1164 N515DRAFT_1164 enoyl-CoA hydratase
Query= reanno::Phaeo:GFF1711 (348 letters) >FitnessBrowser__Dyella79:N515DRAFT_1164 Length = 260 Score = 100 bits (248), Expect = 5e-26 Identities = 85/247 (34%), Positives = 113/247 (45%), Gaps = 18/247 (7%) Query: 3 DIDIRITGRAGRITLTRSKALNALSYDMCMAVDAALKAWADDDAVDLVVMDAEGEKAFCA 62 ++DI G IT+ R LNAL+ D + A A DDAV VV+ G+KAF A Sbjct: 5 NLDIGNRGAVRIITVNRPDKLNALNRDTLNELTLAFAQAAQDDAVRTVVLAGAGDKAFVA 64 Query: 63 GGDIAELYQTGTSGDYDYGRRFWRDEYRMNARIFEYPKPVLSFLQGFVMGGGVGLGCHGT 122 G DIAE+ G + G F R R+ + I KPV++ +QGF +GGG+ L Sbjct: 65 GADIAEM--NGYTPVQAQG--FSRAGQRLMSSIERLGKPVVARIQGFALGGGMELAMACH 120 Query: 123 HRIVGDSTKIAMPEVGIGLIPDVGGTLMLALAPGR-LGEYLGLTGARMTAADAIYAGFAD 181 R+ + + PE+ +GLIP GGT L GR L LTGA + A A G + Sbjct: 121 LRVASEKARFGQPEINLGLIPGFGGTQRLLRLAGRGAALELCLTGAMVGAQRAYELGVVN 180 Query: 182 HYVPETRWPNLISELEQTGRADLLAESAETAPAGTLAPMYDDIGRNFGGETLTDILTALD 241 V + L AD LA SA A AG L + GGE D L+ Sbjct: 181 RVVAPEALDETVDAL-----ADQLAASAPLAAAGILDAILQ------GGEMALD--QGLE 227 Query: 242 HDDSSFA 248 + +FA Sbjct: 228 FETQAFA 234 Lambda K H 0.320 0.137 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 260 Length adjustment: 27 Effective length of query: 321 Effective length of database: 233 Effective search space: 74793 Effective search space used: 74793 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory