GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mmsA in Dyella japonica UNC79MFTsu3.2

Align Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27) (characterized)
to candidate N515DRAFT_4224 N515DRAFT_4224 coniferyl-aldehyde dehydrogenase

Query= reanno::psRCH2:GFF2388
         (503 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_4224 N515DRAFT_4224
           coniferyl-aldehyde dehydrogenase
          Length = 456

 Score =  110 bits (276), Expect = 8e-29
 Identities = 107/379 (28%), Positives = 158/379 (41%), Gaps = 15/379 (3%)

Query: 71  RARIFLKYQQLIRENMKELAAILTAEQGKTLADAEG--DVFRGLEVVEHAAGIGNLQLGE 128
           RAR       LI E+  E+A  +  + G   A      +VF  L  + HA   G   +  
Sbjct: 16  RARRLRALNDLIGEHRGEIADAIHQDFGGRPAQETDLLEVFPSLSAIRHALAHGRRWMKP 75

Query: 129 LAN---NVAAGVDTYTLLQPLGVCAGITPFNFPAMIPLWMFPMAIATGNTFVLKPSEQDP 185
             +    +          QPLGV   I P+N+P  +       A+A GN  ++K SE  P
Sbjct: 76  RRSWPGLLFMPARNEIRPQPLGVVGIIVPWNYPLFLAAGPMVDALAAGNRVMVKMSEYTP 135

Query: 186 MVTMRLCELALEAGVPPGVLNVVHGGPDVVNAICDHPDIKAVSFVGSTKVGTHVYNRASQ 245
             +    +LA     P  V  VV G  DV  A    P    + F GST VG HV   AS 
Sbjct: 136 QFSALFAQLAARYFKPEEVC-VVTGDADVAQAFSALP-FDHLLFTGSTAVGRHVMRAASA 193

Query: 246 AGKRVQCMMGAKNHAIVLPDAHKEQTLNNLAGAAFGAAGQRCMALSVVVLVGEAQAWIPD 305
               V   +G K+ AIV P A     +  +       AGQ C+A   V+L    +A + +
Sbjct: 194 NLTPVTLELGGKSPAIVGPGARFANAVERILVGKLFNAGQTCIAPDYVLL---PRAQVDE 250

Query: 306 LVAKAQTLKVNAGVEA--GTDVGPLVSCAALDRVSGLIERGVREGAKLELDGRNPSVSGY 363
            VA A+ +      +         ++S     R++ L +   R+GAKL L G        
Sbjct: 251 FVAAARDVAARLYPQPVRNEQYASIISERQYQRLAALRDDAARDGAKLTLLGDETDDIQR 310

Query: 364 ENGNFVGPTIFSGVTREMSVYQEEIFGPVLCVMAAATMDEAIELINANPNGNGTAIFTRS 423
                + P + +GV+  M+V QEEIFGP+L ++    +++AI  + A+P+     +F   
Sbjct: 311 RR---MTPALLTGVSESMAVMQEEIFGPLLPLVPYDDIEQAIAYVAAHPHPLALYLFEED 367

Query: 424 GAAARHFQEEIDVGQVGIN 442
           GA           G V IN
Sbjct: 368 GALVDRVLARTTAGGVTIN 386


Lambda     K      H
   0.318    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 506
Number of extensions: 20
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 503
Length of database: 456
Length adjustment: 34
Effective length of query: 469
Effective length of database: 422
Effective search space:   197918
Effective search space used:   197918
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory