GapMind for catabolism of small carbon sources


Aligments for a candidate for prpD in Dyella japonica UNC79MFTsu3.2

Align 2-methylcitrate dehydratase (EC (characterized)
to candidate N515DRAFT_0031 N515DRAFT_0031 2-methylcitrate dehydratase (EC

Query= BRENDA::P74840
         (483 letters)

>lcl|FitnessBrowser__Dyella79:N515DRAFT_0031 N515DRAFT_0031
           2-methylcitrate dehydratase (EC
          Length = 483

 Score =  581 bits (1498), Expect = e-170
 Identities = 295/486 (60%), Positives = 363/486 (74%), Gaps = 6/486 (1%)

           MST +L    RPD D  +VDI DYV++Y I S  AYDTA Y LLD+L   + A+++P C 


            ILA AD+L R AV  G    +++ VL   IKAHEIQGC AL N+FNRVG DHV+LV++A





            +V ++YPIGH RRRA+GIP L+ KF+  +    P  + + IL  + D A L+ MPV E+

Query: 478 LDLYVI 483
           L+L+ +
Sbjct: 478 LELFTL 483

Lambda     K      H
   0.321    0.136    0.408 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 710
Number of extensions: 25
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 483
Length of database: 483
Length adjustment: 34
Effective length of query: 449
Effective length of database: 449
Effective search space:   201601
Effective search space used:   201601
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 52 (24.6 bits)

Align candidate N515DRAFT_0031 N515DRAFT_0031 (2-methylcitrate dehydratase (EC
to HMM TIGR02330 (prpD: 2-methylcitrate dehydratase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02330.hmm
# target sequence database:        /tmp/gapView.26416.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02330  [M=468]
Accession:   TIGR02330
Description: prpD: 2-methylcitrate dehydratase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                    Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                    -----------
   4.9e-227  740.1   0.0   5.5e-227  739.9   0.0    1.0  1  lcl|FitnessBrowser__Dyella79:N515DRAFT_0031  N515DRAFT_0031 2-methylcitrate d

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Dyella79:N515DRAFT_0031  N515DRAFT_0031 2-methylcitrate dehydratase (EC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  739.9   0.0  5.5e-227  5.5e-227       4     467 ..      18     482 ..      15     483 .] 0.99

  Alignments for each domain:
  == domain 1  score: 739.9 bits;  conditional E-value: 5.5e-227
                                    TIGR02330   4 lediadyvleyeidskeaydtaryvlldtlgcgllaleypectkllgpvvegtlvpngarvpgtsy 69 
                                                  ++diadyv++y+ids+eaydtary+lld+l   +la+++pec k+lgp+v+g + p garvpgts+
                                                  789*************************************************************** PP

                                    TIGR02330  70 qldpvkaafnigalvrwldyndtwlaaewghpsdnlggilavadylsrkriaegkeplkvkevlea 135
                                                  +ldp +aaf ig+ +rwld+ndtwlaaewghpsdnlg+ila adyl rk++ eg    ++++vl  
                                                  ****************************************************************** PP

                                    TIGR02330 136 mikaheiqgvlalensfnrvgldhvllvkvastavvakllgatreeilnalshafvdgqalrtyrh 201
                                                   ikaheiqg+ al nsfnrvg dhv+lv++astav++++lg+ +e+i++a+sh+++d++alr+yrh
                                                  ****************************************************************** PP

                                    TIGR02330 202 apntgsrkswaagdatsrgvrlalial.kgemgypsalsapvwgfedvlfkkeklklareygsyvm 266
                                                  apntg rkswaagda+ r+v  a+ a+ +g +gypsalsa++wg++dv f+++ ++++r++gsyvm
                                                  ********************999998648************************************* PP

                                    TIGR02330 267 envlfkisfpaefhaqtaveaavklheevkerldeierivitthesairiidkkgplanpadrdhc 332
                                                  envlfk+s+paefhaqtave+a++lh +v  r++ei+++vi t+e++ riidk+gplan adrdhc
                                                  ****************************************************************** PP

                                    TIGR02330 333 lqylvavpllfgdlvaedyedavaadpridelreklevvedkrysreyleadkrsianavevffkd 398
                                                  +qy+vavpllfg+l+a+dy d+vaadprid+lre++ v e++r++r+y+++d+r i n+v+vffkd
                                                  ****************************************************************** PP

                                    TIGR02330 399 gskteeveveyplghrrrrdegipklvdkfkanlatkfsskkqerilelcldqakleatpvnefld 464
                                                  gs+t++v+++yp+ghrrrr+egip+l  kf+a++  ++++++ + il+ ++d a l+++pv+efl+
                                                  ****************************************************************** PP

                                    TIGR02330 465 lfv 467
  lcl|FitnessBrowser__Dyella79:N515DRAFT_0031 480 LFT 482
                                                  *97 PP

Internal pipeline statistics summary:
Query model(s):                            1  (468 nodes)
Target sequences:                          1  (483 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.03u 0.01s 00:00:00.04 Elapsed: 00:00:00.03
# Mc/sec: 6.73

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory