Align ABC transporter for Xylitol, ATPase component (characterized)
to candidate N515DRAFT_1821 N515DRAFT_1821 putative ABC transport system ATP-binding protein
Query= reanno::Dino:3607124 (338 letters) >FitnessBrowser__Dyella79:N515DRAFT_1821 Length = 238 Score = 130 bits (326), Expect = 4e-35 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 18/245 (7%) Query: 4 IKIDKINKFYGT----TQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGR 59 +K+ ++K Y T T AL D N+D+++GEFV GPSG GK+T L LE + G Sbjct: 2 LKMTHLSKVYRTEVVETYALRDFNIDVKEGEFVAVTGPSGSGKTTFLTIAGLLETFTGGE 61 Query: 60 IEIGGRDVTTVEPADRD------LAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKER 113 + G +V+ + R + +FQ++ L P + V +N+E ++ G + RK+R Sbjct: 62 YHLDGVEVSNLNDNARSKIRNEKIGFIFQAFNLIPDLNVYDNVEVPLRYRGMKALERKQR 121 Query: 114 IAEAARVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMR 173 I +A + L P +LSGGQ+QRVAI RA+ +P + L DEP NLD ++ + Sbjct: 122 IMDALERVGLASRAKHYPAELSGGQQQRVAIARALAGSPRLLLADEPTGNLDTQMARGVM 181 Query: 174 VELEGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKPNSRFVAEF 233 LE +H++ GAT++ VTHD E T A + V + G++ +DL P Sbjct: 182 ELLEEIHRE-GATIVMVTHDP-ELATRAQRNVHVIDGQV------VDLAEDPRFHQQQAR 233 Query: 234 IGSPA 238 G+PA Sbjct: 234 AGAPA 238 Lambda K H 0.320 0.139 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 197 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 338 Length of database: 238 Length adjustment: 26 Effective length of query: 312 Effective length of database: 212 Effective search space: 66144 Effective search space used: 66144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory