Align ABC transporter for Xylitol, permease component 1 (characterized)
to candidate N515DRAFT_3134 N515DRAFT_3134 multiple sugar transport system permease protein
Query= reanno::Dino:3607126 (288 letters) >FitnessBrowser__Dyella79:N515DRAFT_3134 Length = 292 Score = 174 bits (442), Expect = 2e-48 Identities = 99/284 (34%), Positives = 156/284 (54%), Gaps = 7/284 (2%) Query: 6 PRKTVFAFIGPAVIGLALVGIAPLLYALWTSL---HFYNLTKLRRVEFIGLENYWTVLTD 62 P++ + F+ PA++ L L + P++ AL SL Y L +R + F+ L NYW +L Sbjct: 3 PQRAAWLFLAPALLVLGLFFLLPVIAALALSLTDYDLYALADIRDLRFVALGNYWELLHR 62 Query: 63 EVFWQAMGRTFFLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLVLPMATTYAVVG 122 +FW A+G T + + +PL I LG AL+L+ P L K L R +L P+ TT V Sbjct: 63 PLFWSALGHTLYFVLVGVPLSIVASLGAALLLNSP-LARCKPLFRTALFAPVVTTVVAVA 121 Query: 123 LLGQVMFNQKFGVVNQLLGGADIN---WIGDPENAFAMIIFWDVWQWTPFVALVLLAGLT 179 ++ + +FN K+G+ N LGG I+ W+GDP A II + VW+ + ++ LA L Sbjct: 122 VIWRYLFNTKYGLANYALGGLGIHPVDWLGDPRWAMPTIILFAVWKNFGYNMIIFLAALQ 181 Query: 180 MVPGEVEEAARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTRGGPG 239 +P ++ EAAR++ S R++ LP L P L+ V IL + +LF F +T GGP Sbjct: 182 AIPADLYEAARIDGASPLRQFRHITLPMLGPTLLMVGILTVSGYFQLFAEPFVMTEGGPL 241 Query: 240 SSTEFISLMIQRVGFRGFDQGLASAQAIILLIITIVLAQIYIRV 283 ST + ++ GF+ ++ G ASA A +L +I + + +RV Sbjct: 242 QSTTSVLYLMYEEGFKWWNLGSASAVAFLLFLIMFAVTAVMLRV 285 Lambda K H 0.329 0.144 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 270 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 288 Length of database: 292 Length adjustment: 26 Effective length of query: 262 Effective length of database: 266 Effective search space: 69692 Effective search space used: 69692 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory