Align ABC transporter for Xylitol, permease component 2 (characterized)
to candidate N515DRAFT_3133 N515DRAFT_3133 carbohydrate ABC transporter membrane protein 2, CUT1 family (TC 3.A.1.1.-)
Query= reanno::Dino:3607127 (272 letters) >FitnessBrowser__Dyella79:N515DRAFT_3133 Length = 273 Score = 135 bits (341), Expect = 7e-37 Identities = 88/262 (33%), Positives = 141/262 (53%), Gaps = 4/262 (1%) Query: 13 LLVLIITVCVFPFYWMVTTS-LKTQIVALEAPPVWIFEPTLSNYREALFEDGVLRTLINS 71 LL+ V VFP WM++ S ++ + PP+ TL+NY E G+ R L+NS Sbjct: 13 LLIGSTLVAVFPLLWMLSVSFMRPGEASALPPPLLPTHATLANYHELFERAGMGRYLLNS 72 Query: 72 LIIAISTTFLALVLGVPAAFALARFEFRGKKDLWFWFITNRMISPIVLALPFFLIARNLG 131 L ++ + T L+L + A +A A+ F G++ L+ + +I V LP FL+ + LG Sbjct: 73 LGVSSAITLLSLAFNLMAGYAFAKLRFSGRERLFQVLLGGLVIPAQVAMLPLFLLLKYLG 132 Query: 132 LLDKHITLILIYLTFNLPIVIWIVTDQFRGIPYDLDEAARLEGASQFTIMRKICLPLAMP 191 L++ + +++ + I ++V RGIP DL EAAR++GA + I +I LPL P Sbjct: 133 LVNSYAAVVVPAMATIFGI--FLVRQYARGIPDDLMEAARIDGAGELRIFVQIVLPLLKP 190 Query: 192 GVAVSAIFSFIFSWNELMFGLI-LTRSEAKTAPAMAVSFMEGYNLPYGKIMATSTLIVIP 250 + AIF+F+ +WN+ M+ LI LT E T P S + +MA S + V+P Sbjct: 191 IMVTLAIFTFLTAWNDFMWPLIALTGQEHYTLPIALASLSREHVQDSELMMAGSVVTVLP 250 Query: 251 VLIFALIASKQLVRGLTMGAVK 272 VL+ L + ++GL +G+VK Sbjct: 251 VLVLFLALQRYYLQGLLLGSVK 272 Lambda K H 0.331 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 216 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 273 Length adjustment: 25 Effective length of query: 247 Effective length of database: 248 Effective search space: 61256 Effective search space used: 61256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory