Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate N515DRAFT_2043 N515DRAFT_2043 putative ABC transport system ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Dyella79:N515DRAFT_2043 Length = 230 Score = 131 bits (330), Expect = 2e-35 Identities = 79/221 (35%), Positives = 123/221 (55%), Gaps = 10/221 (4%) Query: 4 IHCQALAKHYAGGPP---VLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 I + L+K Y G VLH ++L+I +G+F+ L+GPSG GK+T+L +I GL+ +GG+ Sbjct: 7 IEVRDLSKVYERGKQKVEVLHHINLNIAEGDFLALMGPSGSGKTTLLNLIGGLDSPTGGS 66 Query: 61 LRIGGTVVNDLPA------RERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRR 114 + +GG ++ L A R NV VFQ Y L P ++ N+ L K AA+ + Sbjct: 67 IGVGGQRIDQLGAGALAKWRAANVGFVFQFYNLMPMLTAQRNVELPLLLTKLSAAQRRKN 126 Query: 115 VREVAALLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLR 174 L+ L+ KP +SGGQQQR AIARAI+ P++ + DEP +LD + + Sbjct: 127 AAIALQLVGLDERSSHKPSELSGGQQQRVAIARAIVSDPTLLVCDEPTGDLDRQSAEDVL 186 Query: 175 GDIKRLHQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQ 215 G ++ L++ T V VTHD +A A+ + + G +V+ Sbjct: 187 GLLRTLNREHGKTIVMVTHDP-KAAEYANHTLHLDKGTLVE 226 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 230 Length adjustment: 27 Effective length of query: 379 Effective length of database: 203 Effective search space: 76937 Effective search space used: 76937 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory