Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate N515DRAFT_2307 N515DRAFT_2307 molybdate/tungstate transport system ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Dyella79:N515DRAFT_2307 Length = 331 Score = 125 bits (313), Expect = 2e-33 Identities = 107/328 (32%), Positives = 151/328 (46%), Gaps = 46/328 (14%) Query: 21 HPLDLHIGD--GEFVVLLGPSGCGKSTMLRMIAGLEDISGGTLRIGGTVVNDLPARERNV 78 HP+ LH F VLLG SG GK+ +L IAGL + G + LP ++R V Sbjct: 9 HPVALHASFEVAGFTVLLGASGEGKTLLLSAIAGL-------IAARGEPFDGLPPQQRAV 61 Query: 79 AMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAALLNLEALLERKPRAMSGG 138 + Q +AL+PH+ ++N+AF LR +R + R + + L ER P ++SGG Sbjct: 62 GYLPQGHALFPHLRAWENVAFSLRGARRREQAMQWLER-----VGMAGLAERWPASLSGG 116 Query: 139 QQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRLHQRLRTTTVYVTHDQLEA 198 QQQR A+ARA+ + PS+ L DEP S LD R ++ ++ + + V+HD A Sbjct: 117 QQQRVALARALARRPSLLLLDEPTSALDPVTRDEVLAELIAEVHQAGIPALAVSHDPALA 176 Query: 199 MTLADRVILMQDGRIVQAGSPAELYRYP-----------RNLFAAGFIGTPAMNFLSGTV 247 +ADR++LM RIVQ G+P ++ P RN+ +G P LS Sbjct: 177 -AVADRLVLMHGRRIVQIGTPEAVHAQPASGAVARLLGLRNVQRGRIVGAPGAQRLSW-- 233 Query: 248 QRQDGQLFIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAGEREPAASL--TCPVS 305 D L +ETA L AV V P VR+ +PAA+ S Sbjct: 234 PEADASLRVETA-------------LPDGTAVDWHVPPAAVRL---HDPAAAPGDAIAAS 277 Query: 306 VELVEILGADALLTTRCGDQTLTALVPA 333 EL + L RCG L PA Sbjct: 278 FELRQTSPHRNYLGMRCGKARLWVEPPA 305 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 358 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 331 Length adjustment: 30 Effective length of query: 376 Effective length of database: 301 Effective search space: 113176 Effective search space used: 113176 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory