Align ABC-type sugar transport system, ATPase component protein (characterized, see rationale)
to candidate N515DRAFT_4212 N515DRAFT_4212 multiple sugar transport system ATP-binding protein
Query= uniprot:D8IPI1 (406 letters) >FitnessBrowser__Dyella79:N515DRAFT_4212 Length = 364 Score = 315 bits (808), Expect = 1e-90 Identities = 170/366 (46%), Positives = 227/366 (62%), Gaps = 17/366 (4%) Query: 1 MADIHCQALAKHYAGGPPVLHPLDLHIGDGEFVVLLGPSGCGKSTMLRMIAGLEDISGGT 60 MA + L K Y G + I DGE +VL+GPSGCGK+T+LRMIAGLE ISGGT Sbjct: 1 MAKVRLDKLRKVYPNGHVGVAEASFEIADGELLVLVGPSGCGKTTLLRMIAGLESISGGT 60 Query: 61 LRIGGTVVNDLPARERNVAMVFQNYALYPHMSVYDNIAFGLRRLKRPAAEIDRRVREVAA 120 L IG VVND+ ++R++AMVFQNYALYPHM+V +N+ FGL+ +P AEI+RRV E A Sbjct: 61 LSIGERVVNDIAPKDRDIAMVFQNYALYPHMTVAENLGFGLKLRGQPKAEIERRVAEAAR 120 Query: 121 LLNLEALLERKPRAMSGGQQQRAAIARAIIKTPSVFLFDEPLSNLDAKLRAQLRGDIKRL 180 +L LE L+ +P A+SGGQ+QR A+ RA+++ P VFL DEPLSNLDAKLR +R +I R+ Sbjct: 121 MLELEQRLDSRPAALSGGQRQRVALGRALVRDPKVFLLDEPLSNLDAKLRLSMRVEIARI 180 Query: 181 HQRLRTTTVYVTHDQLEAMTLADRVILMQDGRIVQAGSPAELYRYPRNLFAAGFIGTPAM 240 HQRL+ T VYVTHDQ+EAMTL R++++ G I Q +P LY P NLF AGF+G+PAM Sbjct: 181 HQRLKATMVYVTHDQIEAMTLGQRIVVLNGGVIQQIDTPMNLYDTPANLFVAGFLGSPAM 240 Query: 241 NFLSGTVQRQ--------DGQLFIETAHQRWALTGERFSRLRHAMAVKLAVRPDHVRIAG 292 N L G + R G+L + Q AL R + + +RP+ + + Sbjct: 241 NLLRGILYRDGGWKLAMPQGELVLGELPQGAALEAWR------DRDIVVGLRPEDLLLCA 294 Query: 293 EREPAASLTCPVSVELVEILGADALLTTRCGDQTLTALVPADRLPQPGATLTLALDQHEL 352 + AA +E+VE +G + L R G+ L + +P LP PG+TL L Sbjct: 295 D---AAGAALAAQLEVVEPVGNEVFLNLRHGELALVSRMPPRELPAPGSTLHFGFAPERL 351 Query: 353 HVFDVE 358 H FD + Sbjct: 352 HFFDAK 357 Lambda K H 0.321 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 406 Length of database: 364 Length adjustment: 30 Effective length of query: 376 Effective length of database: 334 Effective search space: 125584 Effective search space used: 125584 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory