Align Putative xylitol transport system substrate-binding protein; SubName: Full=Sugar ABC transporter substrate-binding protein (characterized, see rationale)
to candidate N515DRAFT_3231 N515DRAFT_3231 xylose-binding protein
Query= uniprot:A0A1N7UEK0 (335 letters) >FitnessBrowser__Dyella79:N515DRAFT_3231 Length = 341 Score = 96.3 bits (238), Expect = 1e-24 Identities = 80/268 (29%), Positives = 133/268 (49%), Gaps = 23/268 (8%) Query: 7 LAATAALSLLACSIAMAA----DGKTYKVGAAVYGLKGQFMQNWVRELKEHPAVKD---G 59 L A L+L+A +A+AA GK + + ++ W R+ A + Sbjct: 4 LFARVLLALVATGLAVAALTACSGKASDQPKIGFSIDDMRLERWTRDRDYFVAAAEKLGA 63 Query: 60 TVQLTVFDGNYDALTQNNQIENMVTQRYDAILFVPIDTKAGVGTVKAAMSNDVVVIASNT 119 V + DGN Q Q+EN++++ + ++ VP ++K + A N + VI+ + Sbjct: 64 KVYVQSADGNEQRQVQ--QLENLISRGVNVLVIVPFNSKVLDNVIAEAKRNGIKVISYDR 121 Query: 120 KVADASVP-YVGNDDVEGGRLQAQAMVDKLNGKGNVVIIQG-PIGQSAQIDREKGELEVL 177 + A V Y+ D+ + G LQAQ ++D + KGN ++ G P +A+I RE G+L+VL Sbjct: 122 LILGADVDAYISFDNEKVGELQAQGVLDAVP-KGNYFLLGGSPTDNNAKILRE-GQLKVL 179 Query: 178 GK---HPDIKIIEKK-TANWDRAQALALTEDWLNAHPKGINGVIAQNDDMALGAVQALKS 233 D+KI+ ++ T WD ++AL + ED L A+ I G++A ND A GA+QAL + Sbjct: 180 QPAIDRGDVKIVGQQWTPEWDASKALRIVEDALTANHNDIQGIVASNDATAGGAIQALAA 239 Query: 234 HGLTSK------DVPVTSIDGMPDAIQA 255 L K D + + + D QA Sbjct: 240 QQLAGKVAVSGQDADLAGVRRVVDGTQA 267 Lambda K H 0.314 0.130 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 341 Length adjustment: 28 Effective length of query: 307 Effective length of database: 313 Effective search space: 96091 Effective search space used: 96091 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory