Align Lmo2664 protein (characterized, see rationale)
to candidate N515DRAFT_0878 N515DRAFT_0878 alcohol dehydrogenase
Query= uniprot:Q8Y413 (350 letters) >FitnessBrowser__Dyella79:N515DRAFT_0878 Length = 345 Score = 75.1 bits (183), Expect = 3e-18 Identities = 60/199 (30%), Positives = 93/199 (46%), Gaps = 6/199 (3%) Query: 26 QVRVEVKAVGICGSDIHKMQTRWKYPLPA-VMGHEFAGVITEIGSEVTNV-AMGDRVA-G 82 +V +EV+A GICG+D ++ P V GHE G I +G + +G RV G Sbjct: 30 EVLIEVEACGICGADAADIERANPATRPPRVPGHEVVGRIAALGPGTPSTWKLGQRVGVG 89 Query: 83 IPLEPCMECNYCKAGDFALCDNYRMVGSHFHGGFAENVVMKADNVISIGD-LDFEEGAMI 141 C +C+ C+ G F LC + ++G+ GG+AE +V ++ ++SI D L EE A I Sbjct: 90 RLGGHCNQCDECRRGQFQLCRDQPVLGATCDGGYAEMMVARSTGLVSIPDELRAEEAAPI 149 Query: 142 EPLAVSMHGVL-GIQPRLGDTVIVFGIGTIGILVVQCLLLAGVKDIIAVDISDKKLADAR 200 ++ L GD V V G+G +G + +Q G K + A+ DA Sbjct: 150 LCAGIATFNALKKCGAEAGDLVAVVGVGGLGHMALQYARRMGFK-VAAIGRGQDIAGDAL 208 Query: 201 EFGCKYTINPKNEDLKERV 219 G I+ +D R+ Sbjct: 209 ALGAHVYIDTNEQDAGARL 227 Lambda K H 0.321 0.139 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 18 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 345 Length adjustment: 29 Effective length of query: 321 Effective length of database: 316 Effective search space: 101436 Effective search space used: 101436 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory