Align D-xylulose reductase (EC 1.1.1.9) (characterized)
to candidate N515DRAFT_1006 N515DRAFT_1006 3-oxoacyl-[acyl-carrier protein] reductase
Query= BRENDA::Q8GR61 (262 letters) >FitnessBrowser__Dyella79:N515DRAFT_1006 Length = 248 Score = 122 bits (306), Expect = 7e-33 Identities = 84/260 (32%), Positives = 126/260 (48%), Gaps = 17/260 (6%) Query: 4 KFNGKVCLVTGAGGNIGLATALRLAEEGTAIALLDMNREALEKAEA-SVREKGVEARSYV 62 K GKV LVTGA IG A LA EG A+ + + +A A ++ + G +A + Sbjct: 3 KLKGKVALVTGASKGIGAGIAKALAAEGAAVVVNYASSKAGADAVVDAITKAGGKAVAVK 62 Query: 63 CDVTSEEAVIGTVDSVVRDFGKIDFLFNNAGYQGAFAPVQDYPSDDFARVLTINVTGAFH 122 DV D+ V++FG++D L NN+G FAP++ D F + +NV G Sbjct: 63 GDVAQAADAQAIADAAVKEFGRLDILVNNSGVY-EFAPLEQITEDHFHKQFNVNVLGLLL 121 Query: 123 VLKAVSRQMITQNYGRIVNTASMAGVKGPPNMAAYGTSKGAIIALTETAALDLAPYNIRV 182 +A ++ M G I+N S+ PP + Y +KGA+ A+T + +L P IRV Sbjct: 122 TTQAAAKHM--GEGGSIINIGSLVTRIVPPGGSVYTATKGAVDAITGVLSRELGPRKIRV 179 Query: 183 NAISPGYMGPGFMWERQVELQAKVGSQYFSTDPKVVAQQMIGSVPMRRYGDINEIPGVVA 242 NA++PG VE + V + + +D Q+ I P+ R G +I + Sbjct: 180 NALNPG----------MVETEGTVTAGFIGSD---FHQEAIAHTPLGRIGQPQDIATIAV 226 Query: 243 FLLGDDSSFMTGVNLPIAGG 262 FL DDS ++TG L AGG Sbjct: 227 FLASDDSYWLTGEKLYAAGG 246 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 183 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 262 Length of database: 248 Length adjustment: 24 Effective length of query: 238 Effective length of database: 224 Effective search space: 53312 Effective search space used: 53312 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory