Align SDR family oxidoreductase (characterized, see rationale)
to candidate N515DRAFT_1253 N515DRAFT_1253 2-dehydro-3-deoxy-L-fuconate dehydrogenase (EC 1.1.1.-)
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Dyella79:N515DRAFT_1253 Length = 248 Score = 290 bits (741), Expect = 3e-83 Identities = 152/251 (60%), Positives = 183/251 (72%), Gaps = 5/251 (1%) Query: 5 TGRLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAG-VETHLLDV 63 +GRLAGK L+TAA GIGRA+ FAREGARV+ATDI + L L++ A + T LDV Sbjct: 2 SGRLAGKHALVTAAGAGIGRATALAFAREGARVLATDIDEQALAALSAEAPELRTERLDV 61 Query: 64 TDDDAIKALVAKVGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLNAKAMFHTIRAVLPG 123 TD I LVA DVLFNCAGYV AG IL+ DD AW SF +N +MFH + VLP Sbjct: 62 TDPVQIDRLVASHPPFDVLFNCAGYVHAGTILDTDDAAWKRSFAINVDSMFHLCQRVLPA 121 Query: 124 MLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFVSQGIRCNAICPGT 183 ML + GSIVN++S ASS+KGV NRFAY +KAAV+GLTKSVAADFV +GIRCNAICPGT Sbjct: 122 MLERGGGSIVNMSSVASSIKGVPNRFAYSTTKAAVIGLTKSVAADFVGRGIRCNAICPGT 181 Query: 184 IESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALALYLASDESNFTTG 243 +++PSL R+ + G ED V FV RQPMGR+G EE+A LALYLASDE+ FTTG Sbjct: 182 VKTPSLGDRV----RALGGDEDAVWRGFVERQPMGRLGNPEEIAMLALYLASDEAAFTTG 237 Query: 244 SIHMIDGGWSN 254 ++H++DGGWSN Sbjct: 238 TVHIVDGGWSN 248 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 248 Length adjustment: 24 Effective length of query: 230 Effective length of database: 224 Effective search space: 51520 Effective search space used: 51520 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory