Align SDR family oxidoreductase (characterized, see rationale)
to candidate N515DRAFT_1583 N515DRAFT_1583 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__Dyella79:N515DRAFT_1583 Length = 334 Score = 106 bits (265), Expect = 5e-28 Identities = 89/262 (33%), Positives = 127/262 (48%), Gaps = 35/262 (13%) Query: 7 RLAGKTVLITAAAQGIGRASTELFAREGARVIATDISKTHLEELASIAGVETHLL----- 61 +L G LIT GIGRA LFAREGA D+ +LE H+ Sbjct: 88 KLKGMATLITGGDSGIGRAVAVLFAREGA-----DVGIVYLESSDDAEETRRHVEQEGGR 142 Query: 62 ------DVTDDD----AIKALVAKVGTVDVLFNCAGYVAAGNILE-CDDKAWDFSFNLNA 110 DVTD D A++ V + G +DVL N A + + LE ++ D +F N Sbjct: 143 CLLIQGDVTDPDFCQQAVEETVEEFGHLDVLVNNAAFQEHADTLEDITEEHMDLTFRTNL 202 Query: 111 KAMFHTIRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADFV 170 FH RA LP M K SI+N S + + G Y A+K A+ T+S++A+ V Sbjct: 203 YGYFHMARAALPHM--KAGASIINTGSE-TGLFGNPKLLDYSATKGAIHAFTRSLSANLV 259 Query: 171 SQGIRCNAICPGTIESPSLNQRISTQAKETGKSEDEVRAAFVARQPMGRIGKAEEVAALA 230 +GIR NA+ PG + +P LN A + KS A F + PMGR + EEVA Sbjct: 260 KKGIRVNAVAPGPVWTP-LN-----PADQPAKSV----AKFGSSNPMGRPAQPEEVAPAY 309 Query: 231 LYLASDE-SNFTTGSIHMIDGG 251 ++LA+ +++ +G+I + GG Sbjct: 310 VFLAAPSCASYISGAILPVMGG 331 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 334 Length adjustment: 26 Effective length of query: 228 Effective length of database: 308 Effective search space: 70224 Effective search space used: 70224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory