GapMind for catabolism of small carbon sources

 

Aligments for a candidate for xdh in Dyella japonica UNC79MFTsu3.2

Align NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) (characterized, see rationale)
to candidate N515DRAFT_1230 N515DRAFT_1230 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family

Query= uniprot:A0A4R8NY47
         (263 letters)



>lcl|FitnessBrowser__Dyella79:N515DRAFT_1230 N515DRAFT_1230
           NAD(P)-dependent dehydrogenase, short-chain alcohol
           dehydrogenase family
          Length = 254

 Score =  210 bits (535), Expect = 2e-59
 Identities = 106/252 (42%), Positives = 149/252 (59%)

Query: 10  EHALYRSLAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIATEPSEALVASLKDAAVA 69
           + A Y SL  + V ++GG +GIGAA VE F  QG++V F+DI  E +EAL  SL     A
Sbjct: 3   QFATYPSLIDRHVFVSGGATGIGAAFVEHFARQGSRVTFVDIDREHAEALAQSLAGERHA 62

Query: 70  PRFFPCNLMNLEALRATFTEIETVMGGVDILINNAANDDRHKSEDVTPAYWDERLAVNLR 129
           PRF PC++ +L+AL+A+        G V +L+NNAAND RH   D T   +D  +A+NLR
Sbjct: 63  PRFLPCDITDLDALQASIAAAREAHGPVAVLVNNAANDVRHTFGDTTGEQFDRSIAINLR 122

Query: 130 HQFFCAQAVLPGMRERKGGVILNFGSISWHLGLPDLTLYMTAKAGIEGMTHGMARDFGRD 189
           HQ+F  QAV   MR   GG ++  GS  W        +Y  AK+ + G+ +G+AR+ G D
Sbjct: 123 HQYFATQAVREDMRALGGGSVICLGSTGWMKKNAGYPIYAMAKSAVHGLVNGLARELGHD 182

Query: 190 GVRVNAIIPGAIRTPRQTLLWHTPEEEAKILAAQCLPVRVDPHDVAALALFLSSDSGAKC 249
            +R+NA++PG + T +Q  LW     E +I   QCLP  +   D+A  ALFL +D    C
Sbjct: 183 RIRINALVPGWVITEKQRRLWLDAAGEEEIKRVQCLPGYLMAEDLARAALFLGADDSRMC 242

Query: 250 TGREYYVDAGWL 261
           TG+ + VD GW+
Sbjct: 243 TGQSFLVDGGWV 254


Lambda     K      H
   0.322    0.137    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 203
Number of extensions: 6
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 263
Length of database: 254
Length adjustment: 24
Effective length of query: 239
Effective length of database: 230
Effective search space:    54970
Effective search space used:    54970
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 47 (22.7 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory