Align NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) (characterized, see rationale)
to candidate N515DRAFT_2399 N515DRAFT_2399 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family
Query= uniprot:A0A4R8NY47 (263 letters) >FitnessBrowser__Dyella79:N515DRAFT_2399 Length = 248 Score = 99.8 bits (247), Expect = 5e-26 Identities = 75/247 (30%), Positives = 110/247 (44%), Gaps = 9/247 (3%) Query: 17 LAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIATEPSEALVASLKDAAVAPRFFPCN 76 L K ITGG SGIG + F +GAQV I +E L + K+ + Sbjct: 3 LKNKVAFITGGTSGIGLETAKLFRAEGAQVV---IVGSNAERLAEAGKELGGEVLLVSAD 59 Query: 77 LMNLEALRATFTEIETVMGGVDILINNAANDDRHKSEDVTPAYWDERLAVNLRHQFFCAQ 136 L +E + + G +DI+ NA E +TPAY +E +A+N F Q Sbjct: 60 LRKVEDIEHAVEQARAAFGRIDIVFANAGASTVAPLEAITPAYVEENVALNFAGVLFTIQ 119 Query: 137 AVLPGMRERKGGVILNFGSISWHLGLPDLTLYMTAKAGIEGMTHGMARDFGRDGVRVNAI 196 P + KGG I+ S +G P L++ KA + + + G+RVNA+ Sbjct: 120 KTAPLVP--KGGSIIVTTSFLNTVGKPGLSVLAATKAAARSLVRTLGAELAPRGIRVNAV 177 Query: 197 IPGAIRTPRQTLLWHTPEEEAKILAAQCLPVRV----DPHDVAALALFLSSDSGAKCTGR 252 PG I TP + + T + ++ AA V + DP +VA LFL+S+ + TG Sbjct: 178 SPGTIATPFYSKIGLTDAQLTEVAAALTEQVGLKRFGDPAEVAKAVLFLASNDSSYTTGV 237 Query: 253 EYYVDAG 259 E VD G Sbjct: 238 ELVVDGG 244 Lambda K H 0.322 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 248 Length adjustment: 24 Effective length of query: 239 Effective length of database: 224 Effective search space: 53536 Effective search space used: 53536 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory