GapMind for catabolism of small carbon sources

 

Protein HSERO_RS10775 in Herbaspirillum seropedicae SmR1

Annotation: FitnessBrowser__HerbieS:HSERO_RS10775

Length: 267 amino acids

Source: HerbieS in FitnessBrowser

Candidate for 9 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-arginine catabolism artJ lo Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 99% 150.6 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0
L-histidine catabolism hisJ lo Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 99% 150.6 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0
L-lysine catabolism argT lo Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter periplasmic binding protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 38% 99% 150.6 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0
L-citrulline catabolism AO353_03055 lo ABC transporter for L-Arginine and L-Citrulline, periplasmic substrate-binding component (characterized) 31% 99% 124.4 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0
L-histidine catabolism BPHYT_RS24000 lo Extracellular solute-binding protein family 3; Flags: Precursor (characterized, see rationale) 31% 95% 120.9 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0
L-asparagine catabolism peb1A lo major cell-binding factor (characterized) 32% 98% 115.2 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0
L-aspartate catabolism peb1A lo major cell-binding factor (characterized) 32% 98% 115.2 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0
L-glutamate catabolism peb1A lo major cell-binding factor (characterized) 32% 98% 115.2 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0
L-citrulline catabolism PS417_17590 lo ABC transporter substrate-binding protein; SubName: Full=Histidine transport system substrate-binding protein (characterized, see rationale) 32% 96% 114 L-cystine-binding protein FliY; CBP; Protein FliY; Sulfate starvation-induced protein 7; SSI7 47% 218.0

Sequence Analysis Tools

View HSERO_RS10775 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNKNIKQWLLAGVGAALLASSLSVSAADLLQSVKSSGTLKVALEGNYPPFNFKDPKTGEL
TGFEVDVAKLLAAKLGVKPVFTTTEWSGILAGLGAGKYDVIINQVGITDERQKAFDFSDP
YTLSSAQLIVRKDEKREFKSLEDLKGKKLGLGQGTNFEQKAKAVPGIDVRTYPGSPEYLA
DLAAGRIDAALNDSLLVGYILKSTNLPLKAGSPIGAVDKIGIPFRKGNPEFKAALNKALA
DIKADGSFKAASEKWFGIDVSQPPKAQ

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory