Align C4-dicarboxylate-binding periplasmic protein DctP (characterized)
to candidate HSERO_RS14035 HSERO_RS14035 C4-dicarboxylate ABC transporter
Query= SwissProt::A3QCW5 (336 letters) >FitnessBrowser__HerbieS:HSERO_RS14035 Length = 344 Score = 241 bits (615), Expect = 2e-68 Identities = 128/305 (41%), Positives = 188/305 (61%), Gaps = 1/305 (0%) Query: 33 PTEIKFSHVVAENTPKGQMALKFKQLVEERLPGEYQVNVFPNSQLFGDNNELSALLLNDV 92 P IKFSHVVA +TPKG+ A +FK+L E+ G +V V+PNS L+ D EL AL L V Sbjct: 33 PIIIKFSHVVANDTPKGKGAERFKELAEKATQGRVKVEVYPNSTLYKDKEELEALQLGSV 92 Query: 93 QFVAPSLSKFERY-TKKLQLFDLPFLFKDMDAVNRFQQSDAGQQLLNSMKRKGVVGLGYL 151 Q +APSL+KF ++ ++FDLP++F D + R + GQ L ++ KG+ GL Y Sbjct: 93 QMLAPSLAKFGPLGAREFEVFDLPYIFPDKAVLKRVTEGPIGQGLFQKLEGKGIKGLAYW 152 Query: 152 HNGMKQFSASSPLVLPEDAQGKKFRIMASDVLAAQFQAVEAIPVKKPFSEVFTLLQTRAI 211 NGMK +A+ PL D + K RI +S VL QF+A++A P FSEV+ +QT + Sbjct: 153 DNGMKVMTANRPLHKVADFRALKMRIQSSKVLDEQFRALKANPQVLAFSEVYQAMQTGVV 212 Query: 212 DGQENTWSNIYSKKFYEVQSNITESNHGVLDYMVVTSNTFWKSLPADKRKVIKASLDEAI 271 DG ENT SN+Y++K +EVQSN+T S+HG + Y V+ + FW++LPAD R ++A++ +A Sbjct: 213 DGSENTPSNVYTQKMHEVQSNLTVSDHGYIGYAVIVNKKFWEALPADIRSQLEAAMKQAT 272 Query: 272 AYGNEIAAAKVNKDKQAIIDSKRSEVTYLTPEQRAAWVNAMKPVWAQFEDKIGKDLIDAA 331 Y N IA + + AI S ++ V L+ +++A W A+ PV ++G DLI+A Sbjct: 273 LYANTIAQKENDDALAAIKASGKTRVYTLSEQEKAEWRRALLPVHKSMAARVGADLIEAI 332 Query: 332 VASNE 336 +E Sbjct: 333 YKESE 337 Lambda K H 0.317 0.130 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 269 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 336 Length of database: 344 Length adjustment: 28 Effective length of query: 308 Effective length of database: 316 Effective search space: 97328 Effective search space used: 97328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory