Align Alpha-ketoglutarate permease, MFS superfamily (characterized)
to candidate HSERO_RS00050 HSERO_RS00050 membrane protein
Query= reanno::pseudo3_N2E3:AO353_03810 (439 letters) >FitnessBrowser__HerbieS:HSERO_RS00050 Length = 437 Score = 254 bits (649), Expect = 4e-72 Identities = 141/402 (35%), Positives = 208/402 (51%), Gaps = 7/402 (1%) Query: 26 KSIFSGSVGNMVEWYDWYVYAAFSLYFAKAFFPKGDTTAQLLNTAAIFAVGFLMRPIGGW 85 + + + VGN +EWYD+ VY FS A+ FFP + LL A F +GF MRP+GG Sbjct: 9 RQVIAAIVGNALEWYDFIVYGFFSAIIARLFFPADNEYTSLLVALATFGIGFFMRPVGGV 68 Query: 86 LMGLYADRAGRKAALMASVYLMCFGSLIIALSPGYETIGVGAPILLVFARLLQGLSVGGE 145 L+GLYADR GRKAA+ + LM IIA +P Y TIG+ API++V AR+LQG + GGE Sbjct: 69 LLGLYADRKGRKAAMQVIIVLMTLAIAIIAFTPTYATIGIAAPIMIVVARMLQGFATGGE 128 Query: 146 YGTSATYLSEMATKERRGFFSSFQYVTLISGQLIALGVLIVLQQTLTTEQLYDWGWRIPF 205 Y +S +L E A +RG + S+Q V G+ ++ + L+ E L WGWR+PF Sbjct: 129 YSSSTAFLVESAPAHKRGLYGSWQLVGQCLAVFCGAGMGALVTRNLSPEALDSWGWRLPF 188 Query: 206 AIGALCAIVALYLRRGMEETESFAKKEKSKESAMRTLLRHPKELMTVVGLTMG----GTL 261 +G L V L++RR M ET+ F + +A LL K + V ++MG GT+ Sbjct: 189 VLGLLIGPVGLWIRRHMHETDDFLESANKPNAAPIKLLDVVKTNLRGVLVSMGQVINGTV 248 Query: 262 AFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQPIIGGLSDKVGRRPILIAFGI 321 AFY M + +G+ + + + + L + P G LSD++GRR +L+ + Sbjct: 249 AFYVVLVNMPTFANKQLGLPLDQAFMVQMIAVALLTAVIPFAGALSDRLGRRTVLLYSSL 308 Query: 322 LGTLFTVPILTTLHTIQTWWGAFFLIMAALIIVSGYTSINAVVKAELFPTEIRALGVGLP 381 L P+ + + + + I++ +E FPT +R+ G+ + Sbjct: 309 AFLLMVYPLFVWVSAAPSLPRLLVMQVLLCIVIGANFGPMPTALSEQFPTRVRSTGLAVA 368 Query: 382 YALTVSIFGGTAEYIALWF-KSIGMETGYYWYV--TACIAVS 420 Y L +FGG A +I W K+ G WYV ACI VS Sbjct: 369 YNLAAMLFGGFAPFIVTWLTKTSGSPVAPAWYVLFAACIGVS 410 Lambda K H 0.325 0.138 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 521 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 439 Length of database: 437 Length adjustment: 32 Effective length of query: 407 Effective length of database: 405 Effective search space: 164835 Effective search space used: 164835 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory