Align α-hydroxy-γ-carboxymuconate ε-semialdehyde dehydrogenase subunit (EC 1.1.1.312) (characterized)
to candidate HSERO_RS12100 HSERO_RS12100 oxidoreductase
Query= metacyc::MONOMER-8501 (319 letters) >FitnessBrowser__HerbieS:HSERO_RS12100 Length = 341 Score = 77.0 bits (188), Expect = 6e-19 Identities = 49/141 (34%), Positives = 70/141 (49%), Gaps = 2/141 (1%) Query: 4 TIKVALAGAGAFGIKHLDGIK-NIDGVEVVSLVGRRFDQTKEVADKYGIKHVATDLAESL 62 +++V L G G G +H + I N G + ++ + D L Sbjct: 6 SLQVGLVGLGRMGRRHAENIAFNTPGATLCAVCSPLAQERDWAQQHLPSAERYEDYQALL 65 Query: 63 ALPEVDAVILCTPTQMHAEQAIACMKAGKHVQVEIPLADALKDAQEV-AELQKQTGLVAM 121 P +DAV L TPT +H EQ IA ++AGKHV E PL+ L++ Q V AE + L M Sbjct: 66 RHPGLDAVFLVTPTALHGEQIIAALRAGKHVFCEKPLSLDLEECQRVAAEAARHPQLKVM 125 Query: 122 VGHTRRFNPSHQWVHKKIEAG 142 +G RRF+ S+Q H+KI G Sbjct: 126 IGFVRRFDASYQDAHRKISEG 146 Lambda K H 0.320 0.134 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 231 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 319 Length of database: 341 Length adjustment: 28 Effective length of query: 291 Effective length of database: 313 Effective search space: 91083 Effective search space used: 91083 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory