Align 2-pyrone-4,6-dicarboxylate lactonase (EC 3.1.1.57) (characterized)
to candidate HSERO_RS22275 HSERO_RS22275 2-pyrone-4,6-dicarboxylate hydrolase
Query= BRENDA::D1MW98 (305 letters) >FitnessBrowser__HerbieS:HSERO_RS22275 Length = 315 Score = 157 bits (398), Expect = 2e-43 Identities = 103/281 (36%), Positives = 140/281 (49%), Gaps = 19/281 (6%) Query: 23 KLPAGAVDAHCHVFGPGNEFPFAPERKYTPCDASKAQLYALRDHLGFARNVVVQATCHGA 82 +LP A D H H++ P F +AP K A+ A L+ LG RNVVV + +G Sbjct: 49 RLPDDACDCHMHIYDP--RFAWAPGAKLVHAPATVAMYRQLQQRLGTTRNVVVTPSAYGV 106 Query: 83 DNRAMVDACKSSGGKARGVATVKRSISDAELQELHDAGVRGVRFNFVKRLVDFTPKDELM 142 DN +DA G ARGVA V +SDAELQ LH AGVRG+RFN V E+M Sbjct: 107 DNSCTLDALAQLGRSARGVAVVNDQVSDAELQRLHQAGVRGLRFNLA---VGSVTTVEMM 163 Query: 143 E-IAGRIAKLGWHVVIYFEAVDLPELWDFFTALPTTVVVDHMGRPDVTKGVDSEEFALFL 201 E +A R+A LGWH+ L LP +V DH R + F Sbjct: 164 EPLARRMAPLGWHLQANMPNEVLLAHRAMLARLPVPLVFDHFARIPLQADATHPVFDFVT 223 Query: 202 KFMREHKNVWSKVSCPERLSVSGPKALHGEQNA--YQDVVPFARRVVEEFPERVLWGTDW 259 MRE + + +SG L+ ++ A Y DV P AR +V+ P +++WG+DW Sbjct: 224 GLMRERR---------ASVKLSG-AYLYSKRGAPDYDDVAPLARALVQLAPTQLVWGSDW 273 Query: 260 PHPNLKDHMPDDGLLVDFIPHIAPTAQLQQKLLVDNPMRLY 300 PHP + H PDD L+D + + ++ + +LV NP RLY Sbjct: 274 PHPT-EQHKPDDARLLDVMISWLGSEEMVRTVLVANPARLY 313 Lambda K H 0.321 0.138 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 18 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 315 Length adjustment: 27 Effective length of query: 278 Effective length of database: 288 Effective search space: 80064 Effective search space used: 80064 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory