Align 3-carboxy-cis,cis-muconate cycloisomerase; EC 5.5.1.2 (characterized, see rationale)
to candidate HSERO_RS19930 HSERO_RS19930 3-carboxy-cis,cis-muconate cycloisomerase
Query= uniprot:A0A0C4YE08 (470 letters) >FitnessBrowser__HerbieS:HSERO_RS19930 Length = 455 Score = 349 bits (896), Expect = e-100 Identities = 198/430 (46%), Positives = 248/430 (57%) Query: 4 SSRLTDPMFGSAATLAAFSDTATVQRMLDFEAALARAEASCGVIPADAAEAIAATCRAGE 63 S + D ++ +A F D A VQ ML FE LA A+A+ GVIP AA AIA+ CRA Sbjct: 2 SVSIFDSFLTTSEMIAVFDDQAVVQAMLRFEQVLAEAQAAEGVIPDAAARAIASVCRAPL 61 Query: 64 IDFDALAAAAVAGGNLAIPLVRQLTARVAARDAQAARYVHWGATSQDAIDTGMVLQLREA 123 D AL A G LAIPLV++L VA +AA +VHWG+TSQD +DT MVL REA Sbjct: 62 YDIPALIVAGRRAGALAIPLVKELQRTVALYSEEAATHVHWGSTSQDVLDTAMVLVTREA 121 Query: 124 LQAVDADLKALGHACAALAAQHRDTPMVARTWLQHALPTTFGLKAAGWLDALRRDLRRLD 183 L+ V+ +L+ L LA H DTP++ART +Q A T+ GLK W L R +L Sbjct: 122 LRLVEGELEQLSRRLLDLAQSHLDTPVLARTLMQPAQVTSLGLKFCNWAAPLLRSRAQLQ 181 Query: 184 AARAQAATLQFGGAAGTLASLGAAAPAVATALGSALSLAVAPTPWHAYRDRMVEVATTLG 243 A +A LQ GGA GTL LG PAVA + +AL L WH RD+ + + + Sbjct: 182 ALAERALQLQLGGAVGTLTVLGEKGPAVAARMAAALELKTPEAAWHTQRDQWIRLGAEMA 241 Query: 244 MLTGSLGKIARDVSLMMQTEVAEVAEPTGPGRGGSSTMPHKRNPVGCAAVLTAAVRVPPL 303 +L GSLGKIA D+SLM Q E+AE+AEP+G GRGGSS MPHKRNPV L AA R P Sbjct: 242 VLAGSLGKIATDLSLMAQGEIAELAEPSGNGRGGSSAMPHKRNPVSSMIALAAAARAPQQ 301 Query: 304 VATMLAGMVQEHERALGGWQAEWDTLPQIVTLAAGALRQMLEVVGGLQVDAARMRANLGV 363 A +LA M Q+HER LG WQAE P + GALR + + GL +DA RM N+ Sbjct: 302 AAALLAAMSQQHERGLGNWQAELAEWPALFLGVHGALRALNDAFAGLVIDAPRMLRNIDA 361 Query: 364 THGLILAEAAMLELGGKIGRLPAHHLVEGACRRAVAEGTTLRQALGATLAEDAAHAGLMD 423 GL+ AE+A + L G IGR AH L+E R+AVA+G L L + DA +D Sbjct: 362 LQGLVFAESASIALAGVIGRPRAHSLLEQLTRKAVADGAQLVDVLVDAVQADAQLRKEID 421 Query: 424 AAALDRVCDP 433 L + DP Sbjct: 422 LPMLRGLFDP 431 Lambda K H 0.319 0.130 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 376 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 470 Length of database: 455 Length adjustment: 33 Effective length of query: 437 Effective length of database: 422 Effective search space: 184414 Effective search space used: 184414 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate HSERO_RS19930 HSERO_RS19930 (3-carboxy-cis,cis-muconate cycloisomerase)
to HMM TIGR02426 (pcaB: 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02426.hmm # target sequence database: /tmp/gapView.16904.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02426 [M=338] Accession: TIGR02426 Description: protocat_pcaB: 3-carboxy-cis,cis-muconate cycloisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.3e-115 369.4 22.0 1.2e-114 368.7 22.0 1.3 1 lcl|FitnessBrowser__HerbieS:HSERO_RS19930 HSERO_RS19930 3-carboxy-cis,cis- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS19930 HSERO_RS19930 3-carboxy-cis,cis-muconate cycloisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 368.7 22.0 1.2e-114 1.2e-114 3 338 .] 7 348 .. 5 348 .. 0.98 Alignments for each domain: == domain 1 score: 368.7 bits; conditional E-value: 1.2e-114 TIGR02426 3 dglfgdseaaelfsdrarlramldvEaalaraqadvGlipaeaaeaiaaaaaelalDlealaeaaaea 70 d + ++se+ ++f+d+a ++aml++E +la+aqa+ G+ip++aa+aia+++++ +D+ al a ++a lcl|FitnessBrowser__HerbieS:HSERO_RS19930 7 DSFLTTSEMIAVFDDQAVVQAMLRFEQVLAEAQAAEGVIPDAAARAIASVCRAPLYDIPALIVAGRRA 74 677899************************************************************** PP TIGR02426 71 gnvviplvkalrkavae...eaaryvHlGaTSQDviDTalmLqlrdaldllladlerlaeaLaelaar 135 g ++iplvk+l+++va eaa +vH+G TSQDv+DTa++L+ r+al l++ +le+l+++L +la++ lcl|FitnessBrowser__HerbieS:HSERO_RS19930 75 GALAIPLVKELQRTVALyseEAATHVHWGSTSQDVLDTAMVLVTREALRLVEGELEQLSRRLLDLAQS 142 ***************97778************************************************ PP TIGR02426 136 hrdtpltarTllQqAvpttvglkaagwlaavlrardrlealrtealalqfGGAaGtlaalekkglava 203 h dtp++arTl+Q+A+ t +glk+ +w a++lr+r++l+al+++al+lq+GGA+Gtl+ l++kg ava lcl|FitnessBrowser__HerbieS:HSERO_RS19930 143 HLDTPVLARTLMQPAQVTSLGLKFCNWAAPLLRSRAQLQALAERALQLQLGGAVGTLTVLGEKGPAVA 210 ******************************************************************** PP TIGR02426 204 ealAaelgLeapalpWhtqrdriaelaaaLalvagalgkiaqDvallaqtevgevle.agg...GGSS 267 +++Aa+l+L++p++ Whtqrd+ +l+a +a++ag+lgkia+D++l+aq e++e++e + g GGSS lcl|FitnessBrowser__HerbieS:HSERO_RS19930 211 ARMAAALELKTPEAAWHTQRDQWIRLGAEMAVLAGSLGKIATDLSLMAQGEIAELAEpS-GngrGGSS 277 *********************************************************64.3479**** PP TIGR02426 268 ampHKrNPvaaevlaaaarrapglvatLfaalaqedeRsaggWhaeWetLrelvaltagalrqaaell 335 ampHKrNPv +++++aaa+rap+++a+L+aa+ q++eR++g+W+ae + + l+ ++galr+ ++ lcl|FitnessBrowser__HerbieS:HSERO_RS19930 278 AMPHKRNPVSSMIALAAAARAPQQAAALLAAMSQQHERGLGNWQAELAEWPALFLGVHGALRALNDAF 345 ***************************************************************99988 PP TIGR02426 336 egl 338 +gl lcl|FitnessBrowser__HerbieS:HSERO_RS19930 346 AGL 348 886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (338 nodes) Target sequences: 1 (455 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.42 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory