Align 4-carboxymuconolactone decarboxylase; CMD; EC 4.1.1.44 (uncharacterized)
to candidate HSERO_RS19935 HSERO_RS19935 hydrolase
Query= curated2:P20370 (134 letters) >FitnessBrowser__HerbieS:HSERO_RS19935 Length = 420 Score = 116 bits (290), Expect = 4e-31 Identities = 51/123 (41%), Positives = 84/123 (68%), Gaps = 4/123 (3%) Query: 7 YKQGLEVRTEVLGEKHVNRSLENLNDFNQDFQNFISRFAWGEVWSRPGLPRHTRSLVTIA 66 +++G+ R VLG++ V+RS+ N +FN DFQN I+RFAW E+W RPGL TR ++ +A Sbjct: 10 FERGMRNRRSVLGDQWVDRSVANATNFNADFQNLITRFAWNEIWGRPGLDHKTRRIIVLA 69 Query: 67 VLLALGREDELRMHLRACFN----NGVTKDELKELILHCSLYAGLPASNAAMHMAEEVFK 122 + +ALGR +E +H+RA +T DE+KE+++ ++YAG+PA N A A+++ + Sbjct: 70 ITIALGRWEEFELHVRAGLTADPATRLTPDEMKEVMIQAAVYAGVPAGNTAFTHAQKILR 129 Query: 123 DLG 125 ++G Sbjct: 130 EVG 132 Lambda K H 0.320 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 124 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 134 Length of database: 420 Length adjustment: 23 Effective length of query: 111 Effective length of database: 397 Effective search space: 44067 Effective search space used: 44067 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory