GapMind for catabolism of small carbon sources

 

Alignments for a candidate for pcaF in Herbaspirillum seropedicae SmR1

Align β-ketoadipyl-CoA thiolase (EC 2.3.1.174; EC 2.3.1.223) (characterized)
to candidate HSERO_RS19990 HSERO_RS19990 acetyl-CoA acetyltransferase

Query= metacyc::MONOMER-15952
         (401 letters)



>FitnessBrowser__HerbieS:HSERO_RS19990
          Length = 400

 Score =  577 bits (1486), Expect = e-169
 Identities = 289/401 (72%), Positives = 338/401 (84%), Gaps = 1/401 (0%)

Query: 1   MNEALIIDAVRTPIGRYAGALASVRADDLGAIPLKALIARHPQLDWSAVDDVIYGCANQA 60
           M +  I DA+RTPIGRY GAL  VRADDLGA+PL+AL+ R+PQ+DW AVDDVIYGCANQA
Sbjct: 1   MKDVFICDAIRTPIGRYGGALKDVRADDLGAVPLRALMERNPQVDWKAVDDVIYGCANQA 60

Query: 61  GEDNRNVARMAALLAGLPVSVPGTTLNRLCGSGLDAVGSAARALRCGEAGLMLAGGVESM 120
           GEDNRNVARM+ LLAGLP  VPG+T+NRLCGSG+DA+G+AARA++ GE  LM+AGGVESM
Sbjct: 61  GEDNRNVARMSLLLAGLPQEVPGSTINRLCGSGMDALGTAARAIKSGETQLMIAGGVESM 120

Query: 121 SRAPFVMGKSEQAFGRSAEIFDTTIGWRFVNKLMQQGFGIDSMPETAENVAAQFNISRAD 180
           +RAPFVMGK++ AF R A I DTTIGWRFVN LM+Q +G+D+MPETAENVA  F +SRAD
Sbjct: 121 TRAPFVMGKADSAFSRQAAIQDTTIGWRFVNALMKQKYGVDAMPETAENVAVDFKVSRAD 180

Query: 181 QDAFALRSQHKAAAAIANGRLAKEIVAVEIAQRKGPAKIVEHDEHPRGDTTLEQLAKLGT 240
           QD FA+RSQ KAAAA ANG LA+EIV V I Q+KG    V  DEHPR  T++E LA+L  
Sbjct: 181 QDQFAVRSQAKAAAAQANGTLAQEIVPVVIPQKKGDPITVTQDEHPRA-TSMEALARLKG 239

Query: 241 PFRQGGSVTAGNASGVNDGACALLLASSEAAQRHGLKARARVVGMATAGVEPRIMGIGPV 300
             +  GSVTAGNASGVNDGACALLLAS+EA +++ LK RAR++GMATAGV PRIMG+GP 
Sbjct: 240 VVKPDGSVTAGNASGVNDGACALLLASAEAVEKYQLKPRARILGMATAGVAPRIMGMGPA 299

Query: 301 PATRKVLELTGLALADMDVIELNEAFAAQGLAVLRELGLADDDERVNPNGGAIALGHPLG 360
           PA++KVL   G+ +  MDVIELNEAFA+QGLAVLRELG+ADDD RVNPNGGAIALGHPLG
Sbjct: 300 PASKKVLAQLGMTIDQMDVIELNEAFASQGLAVLRELGVADDDARVNPNGGAIALGHPLG 359

Query: 361 MSGARLVTTALHELEERQGRYALCTMCIGVGQGIALIIERI 401
           MSGARLVTTA ++LE   GRYALCTMCIGVGQGIA++IER+
Sbjct: 360 MSGARLVTTATYQLERTGGRYALCTMCIGVGQGIAMVIERV 400


Lambda     K      H
   0.319    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 549
Number of extensions: 12
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 401
Length of database: 400
Length adjustment: 31
Effective length of query: 370
Effective length of database: 369
Effective search space:   136530
Effective search space used:   136530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate HSERO_RS19990 HSERO_RS19990 (acetyl-CoA acetyltransferase)
to HMM TIGR02430 (pcaF: 3-oxoadipyl-CoA thiolase (EC 2.3.1.174))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR02430.hmm
# target sequence database:        /tmp/gapView.31379.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR02430  [M=400]
Accession:   TIGR02430
Description: pcaF: 3-oxoadipyl-CoA thiolase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
   2.3e-227  740.6  13.0   2.6e-227  740.4  13.0    1.0  1  lcl|FitnessBrowser__HerbieS:HSERO_RS19990  HSERO_RS19990 acetyl-CoA acetylt


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__HerbieS:HSERO_RS19990  HSERO_RS19990 acetyl-CoA acetyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  740.4  13.0  2.6e-227  2.6e-227       1     400 []       2     400 .]       2     400 .] 1.00

  Alignments for each domain:
  == domain 1  score: 740.4 bits;  conditional E-value: 2.6e-227
                                  TIGR02430   1 kevyivdairtpiGrygGslssvraddlaavplkallarnpsldaaaiddvilGcanqaGednrnvar 68 
                                                k+v+i+dairtpiGrygG+l  vraddl+avpl+al++rnp++d++a+ddvi+GcanqaGednrnvar
  lcl|FitnessBrowser__HerbieS:HSERO_RS19990   2 KDVFICDAIRTPIGRYGGALKDVRADDLGAVPLRALMERNPQVDWKAVDDVIYGCANQAGEDNRNVAR 69 
                                                689***************************************************************** PP

                                  TIGR02430  69 maallaGlpvsvpgttvnrlcgsgldalglaaraikaGeadlviaGGvesmsrapfvlGkadsafsrs 136
                                                m++llaGlp++vpg+t+nrlcgsg+dalg+aaraik+Ge++l+iaGGvesm+rapfv+Gkadsafsr+
  lcl|FitnessBrowser__HerbieS:HSERO_RS19990  70 MSLLLAGLPQEVPGSTINRLCGSGMDALGTAARAIKSGETQLMIAGGVESMTRAPFVMGKADSAFSRQ 137
                                                ******************************************************************** PP

                                  TIGR02430 137 akledttiGwrfvnpklkalyGvdsmpetaenvaeefgvsredqdafalrsqqrtaaaqakGffaeei 204
                                                a ++dttiGwrfvn  +k+ yGvd+mpetaenva +f+vsr+dqd+fa+rsq+++aaaqa+G +a+ei
  lcl|FitnessBrowser__HerbieS:HSERO_RS19990 138 AAIQDTTIGWRFVNALMKQKYGVDAMPETAENVAVDFKVSRADQDQFAVRSQAKAAAAQANGTLAQEI 205
                                                ******************************************************************** PP

                                  TIGR02430 205 vpveikqkkGeetvvdkdehlraettlealaklkavvredgtvtaGnasGvndGaaalllaseeavkr 272
                                                vpv+i+qkkG++ +v +deh+r  t++eala+lk+vv++dg+vtaGnasGvndGa+alllas+eav++
  lcl|FitnessBrowser__HerbieS:HSERO_RS19990 206 VPVVIPQKKGDPITVTQDEHPR-ATSMEALARLKGVVKPDGSVTAGNASGVNDGACALLLASAEAVEK 272
                                                **********************.8******************************************** PP

                                  TIGR02430 273 hgltprarilaaasaGveprvmGlgpvpavkkllaraglsledldvielneafaaqalavlrelglad 340
                                                ++l+praril++a+aGv+pr+mG+gp+pa kk+la++g++++++dvielneafa+q+lavlrelg+ad
  lcl|FitnessBrowser__HerbieS:HSERO_RS19990 273 YQLKPRARILGMATAGVAPRIMGMGPAPASKKVLAQLGMTIDQMDVIELNEAFASQGLAVLRELGVAD 340
                                                ******************************************************************** PP

                                  TIGR02430 341 ddarvnpnGGaialGhplGasGarlvltalkqleksggryalatlciGvGqGialvierv 400
                                                ddarvnpnGGaialGhplG+sGarlv+ta +qle++ggryal+t+ciGvGqGia+vierv
  lcl|FitnessBrowser__HerbieS:HSERO_RS19990 341 DDARVNPNGGAIALGHPLGMSGARLVTTATYQLERTGGRYALCTMCIGVGQGIAMVIERV 400
                                                ***********************************************************8 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (400 nodes)
Target sequences:                          1  (400 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 7.48
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory