Align D-alanine dehydrogenase (EC 1.4.99.-) (characterized)
to candidate HSERO_RS07275 HSERO_RS07275 D-amino acid dehydrogenase
Query= reanno::acidovorax_3H11:Ac3H11_4848 (445 letters) >FitnessBrowser__HerbieS:HSERO_RS07275 Length = 436 Score = 416 bits (1070), Expect = e-121 Identities = 209/440 (47%), Positives = 288/440 (65%), Gaps = 15/440 (3%) Query: 1 MKTIVLGAGIIGISTAWHLLERGHEVIVIDRQPDAALETSFANAAQISVSYCEPWANREA 60 MK IVLGAGIIG ++AW L ++G++V VIDRQP AA ETSFAN QISVS+ EPWAN A Sbjct: 1 MKVIVLGAGIIGTASAWFLKKQGYDVTVIDRQPGAAQETSFANGCQISVSHAEPWANPAA 60 Query: 61 PLKALKWMFDKEAPLLFRPQMDWQQWRWGLQFLAQCNDTAFERNVQQIVALGAYSHAALK 120 P+K LKW+ ++APLL+R + +W QW+W + FL +C + N++ IVAL YS L+ Sbjct: 61 PMKVLKWLGKEDAPLLYRFRPEWLQWKWAVAFLRECTAARTDENIRNIVALCEYSRQTLQ 120 Query: 121 DLVGTTGIEYNRLERGIAHFYTDQKSFDAAGHAVELMRKHGVQRRLVSRDELLQIEPAFR 180 + TGI+Y+ L RGI HFYT++K F + A +LMR G R + DE+++IEPA Sbjct: 121 AVRAETGIQYDHLTRGILHFYTEEKEFQDSLPAAKLMRDLGCPRESIGADEVVRIEPALA 180 Query: 181 AYGDKITGGTYTSTDESGDARVFTQELARRCIARGAQFLYGHDVLRL--NKIGNAIDSVA 238 + +KI GG +T+TDESGD T LA++ G +F Y + RL G A Sbjct: 181 SIRNKIVGGDFTATDESGDVFKLTTGLAKKSAEAGVEFRYSTTITRLITEGAGAAARVTG 240 Query: 239 VMARQPGGGGKKDFILKADAVVVACGSYSAPLLRSVGVDLPIYPGKGYSATFPLLRPEGA 298 V P G + +LKAD VVA GS+S L++ +G+DL +YPGKGYSAT+ + P+ A Sbjct: 241 VEIINPDG---RHEVLKADTFVVAMGSFSQQLVKPLGIDLLLYPGKGYSATYQITNPDAA 297 Query: 299 PMVSTIDDGKKIAMSRLGNHLRVAGTIELNGWDLTLDSSLARARCHMLSRRIEAILPGVC 358 P VS DDG K+ +SRLG+ LRVAGT ELNG+ L+++ RC ++RR + P C Sbjct: 298 PTVSLTDDGYKLVVSRLGDRLRVAGTCELNGYTRELNTT----RCEAITRRTRELFPDGC 353 Query: 359 DTRTPEEGGDPQYWTGLRPATPTNIPFIGRTRVGKLWVNAGHGTLGWTHGAGSGKALAEL 418 D +P YWTGLRP TP+N+P++G+T+ L++N GHGTLGWT G GSG+A+AE+ Sbjct: 354 DYE------NPTYWTGLRPLTPSNVPYVGKTKFANLYLNTGHGTLGWTMGCGSGRAIAEI 407 Query: 419 ISGQVPAMNFGFCGMEQGNR 438 ++G VP ++F F G+ + NR Sbjct: 408 VAGHVPEIDFAFTGLPRWNR 427 Lambda K H 0.321 0.137 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 545 Number of extensions: 31 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 436 Length adjustment: 32 Effective length of query: 413 Effective length of database: 404 Effective search space: 166852 Effective search space used: 166852 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory