Align lactate dehydrogenase (NAD+, ferredoxin) (subunit 2/3) (EC 1.3.1.110) (characterized)
to candidate HSERO_RS07560 HSERO_RS07560 electron transfer flavoprotein subunit beta
Query= BRENDA::H6LBB1 (418 letters) >FitnessBrowser__HerbieS:HSERO_RS07560 Length = 309 Score = 145 bits (365), Expect = 2e-39 Identities = 100/300 (33%), Positives = 160/300 (53%), Gaps = 23/300 (7%) Query: 100 AAVIGHPVYALLMGTNITEKADELLKY-GVDKVFVYDKPELKHFVIEPYANVLEDFIEKV 158 AA G V+ L+ G+N AD + GV KV + D P+ + E NV E + Sbjct: 25 AAQAGGDVHVLVAGSNAKAAADAAAQVAGVTKVLLADAPQFADGLAE---NVAEQVLAIA 81 Query: 159 KP-SSILVGATNVGRSLAPRVAARYRTGLTADCTILEMKENTDLVQIRPAFGGNIMAQIV 217 K S IL AT G+++ PRVAA+ G +D T +E + + RP + GN +A + Sbjct: 82 KDYSHILAPATAYGKNILPRVAAKLDVGQISDITKVESADTFE----RPIYAGNAIATVQ 137 Query: 218 TENTRPQFCTVRYKVFTAPERVNEPWGDVEMMDIEKAKLV-----SAIEVMEVIKKEKGI 272 + + KV T +P +E V S+ EV K ++ Sbjct: 138 SIDP--------IKVITVRTTGFDPAAQGGSAAVESIPAVADSGKSSFVGREVAKSDRP- 188 Query: 273 DLSEAETIVAVGRGVKCEKDLDMIHEFAEKIGATVACTRPGIEAGWFDARLQIGLSGRTV 332 +L+ A+ IV+ GRG+ + ++ A+K+ A + +R ++AG+ Q+G +G+ V Sbjct: 189 ELTAAKIIVSGGRGMGSAESFKILEPLADKLNAAMGASRAAVDAGYVPNDWQVGQTGKIV 248 Query: 333 KPKLIIALGISGAVQFAAGMQNSEYIIAINSDPKAPIFNIAHCGMVGDLYEILPELLTMI 392 P+L IA+GISGA+Q AGM++S+ I+AIN D +APIF++A G+VGDL+E++PEL+ + Sbjct: 249 APQLYIAVGISGAIQHLAGMKDSKVIVAINKDEEAPIFSVADYGLVGDLFEVVPELVKQL 308 Lambda K H 0.319 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 280 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 309 Length adjustment: 29 Effective length of query: 389 Effective length of database: 280 Effective search space: 108920 Effective search space used: 108920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory