Align N-Acetyl-D-glucosamine ABC transport system, permease component 2 (characterized)
to candidate HSERO_RS02200 HSERO_RS02200 mannitol ABC transporter permease
Query= reanno::Phaeo:GFF2752 (280 letters) >FitnessBrowser__HerbieS:HSERO_RS02200 Length = 271 Score = 120 bits (301), Expect = 3e-32 Identities = 83/263 (31%), Positives = 137/263 (52%), Gaps = 17/263 (6%) Query: 24 LIALFPVFVILVNSFKTRKAIFRDPLG-LPTSDTFSLVGYQTVLKQGDFFLYFQNSMIVT 82 ++ FP+F + V +FKT + L LPT +TF + V + + Y QNS+IV+ Sbjct: 20 IVLFFPIFWVAVTAFKTESQAYTPSLVFLPTLETF-----REVFSRSHYLGYVQNSLIVS 74 Query: 83 VVSLALVLLFGAMAAFALAEYRFKGNMLLGLYLALGIMIPIRIGTVAILELMV-DTGLVN 141 + S L LL AA+++A + L L++ M+P +G + + LM +TGL++ Sbjct: 75 LGSTLLSLLLAVPAAYSMAFFPTGRTQKLLLWMLSTKMMPA-VGVLIPIYLMAKNTGLLD 133 Query: 142 TLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGRIDGLSEYTIFFRLVLPLVRPAMA 201 T+T L ++YT LP+AV++ + V ++ A RIDG + + L+LP P +A Sbjct: 134 TVTGLTIIYTLINLPIAVWMAFTYFNDVPKEILEAARIDGANAWQEMIYLLLPTAMPGLA 193 Query: 202 TVAVFNMIPIWNDLWFPLILAPAEETKTLTLGSQVFIGQFVTD----WNAVLSALSMAIL 257 + A+ +I WN+ ++ L L T VFI + W + +A +AI Sbjct: 194 STALLLVILSWNEAFWSLNL-----TSVNAAPLTVFIASYSNPEGLFWAKLSAASLLAIA 248 Query: 258 PVMVLYVIFSRQLIRGITSGAVK 280 P+M L + +QL+RG+T GAVK Sbjct: 249 PIMALGWLAQKQLVRGLTFGAVK 271 Lambda K H 0.330 0.143 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 280 Length of database: 271 Length adjustment: 25 Effective length of query: 255 Effective length of database: 246 Effective search space: 62730 Effective search space used: 62730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory