Align Organic acid uptake porter, DctA of 444 aas and 8 - 10 putative TMSs (characterized)
to candidate HSERO_RS22690 HSERO_RS22690 C4-dicarboxylate ABC transporter
Query= TCDB::Q848I3 (444 letters) >FitnessBrowser__HerbieS:HSERO_RS22690 Length = 444 Score = 436 bits (1122), Expect = e-127 Identities = 228/427 (53%), Positives = 306/427 (71%), Gaps = 5/427 (1%) Query: 7 LYKSLYFQVIVAIAIGILLGHFYPQTGVALKPLGDGFIKLIKMVIAPIIFCTVVSGIAGM 66 L+KSL+ QV++A+ GI++G F+P G LKPLGDGFIKLIKM+I I+FC VV GI G Sbjct: 4 LFKSLFGQVVLALIGGIIIGLFWPDFGQNLKPLGDGFIKLIKMIIPVIVFCVVVQGICGA 63 Query: 67 QNMKSVGKTGGYALLYFEIVSTIALLIGLVVVNVVQPGNGMHIDVSTLDASKVAAYVT-A 125 ++K VG G A++YFE+V+TIALL+GLV+ VVQPG GM+ID S LDAS ++ Y+ A Sbjct: 64 SDLKKVGSVGVKAIIYFEVVTTIALLLGLVLALVVQPGAGMNIDPSNLDASSLSGYMANA 123 Query: 126 GK--DQSIVGFILNVIPNTIVGAFANGDILQVLMFSVIFGFALHRLGAYGKPVLDFIDRF 183 GK + FI+ +IP T V AF +GD+LQVL+ SV FG AL +G G PV+ + Sbjct: 124 GKVKETGFAEFIMKLIPATAVSAFTSGDVLQVLLISVTFGCALLLIGEKGAPVVALVASL 183 Query: 184 AHVMFNIINMIMKLAPIGALGAMAFTIGAYGVGSLVQLGQLMICFYITCVLFVLVVLGAI 243 + F ++ ++LAP+G LGA+AFT+G YG+GSL QL L++ FY + FVLVVLG I Sbjct: 184 SDAFFKCMSFFIRLAPLGVLGAIAFTVGKYGIGSLKQLALLVLLFYGAVIFFVLVVLGGI 243 Query: 244 CRAHGFSVLKLIRYIREELLIVLGTSSSESALPRMLIKMERLGAKKSVVGLVIPTGYSFN 303 RA G S+ KLIRY+REEL++VL T+SS+S LP+++ K+E +G KKS VGLVIPTGYSFN Sbjct: 244 LRASGLSIFKLIRYLREELVVVLATTSSDSVLPQIMKKLEHMGIKKSTVGLVIPTGYSFN 303 Query: 304 LDGTSIYLTMAAVFIAQATDTHMDITHQITLLLVLLLSSKGAAGVTGSGFIVLAATLSAV 363 LD SIYLTMAA+FIAQAT+TH+ + +L + L++SKGA GV GS ++LAATL+ + Sbjct: 304 LDAFSIYLTMAALFIAQATNTHLSMGDLAAILAIALVTSKGAHGVPGSAIVILAATLTTI 363 Query: 364 GHLPVAGLALILGIDRFMSEARALTNLVGNAVATVVVAKWVKELDEDQLQAELASGGRAI 423 +PV GL L+L ID F+ ARAL NL+GN VATVV+A W E D D+++A G ++ Sbjct: 364 PAIPVVGLVLVLSIDWFIGIARALGNLLGNCVATVVIASW--ERDIDKVRARAVLNGESV 421 Query: 424 SDTREED 430 + EE+ Sbjct: 422 APLVEEN 428 Lambda K H 0.326 0.142 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 585 Number of extensions: 24 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 444 Length of database: 444 Length adjustment: 32 Effective length of query: 412 Effective length of database: 412 Effective search space: 169744 Effective search space used: 169744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory