Align CVE1 aka ChvE aka ATU2348 aka AGR_C_4267, component of Multiple sugar (arabinose, xylose, galactose, glucose, fucose) putative porter (characterized)
to candidate HSERO_RS22460 HSERO_RS22460 xylose ABC transporter substrate-binding protein
Query= TCDB::P25548 (354 letters) >FitnessBrowser__HerbieS:HSERO_RS22460 Length = 338 Score = 201 bits (511), Expect = 2e-56 Identities = 127/352 (36%), Positives = 198/352 (56%), Gaps = 23/352 (6%) Query: 2 KSIISLMAACAIGAASFAAPAFAQDKGSVGIAMPTKSSARWIDDGNNIVKQLQEAGYKTD 61 K++++LM + + +A A A++ +G ++ RW D + ++ G K Sbjct: 7 KTVLALMTVTTLSMVAGSAMADAKNP-KIGFSIDDLRVERWARDRDFFTAAAEKLGAKVY 65 Query: 62 LQYADDDIPNQLSQIENMVTKGVKVLVIASIDGTTLSDVLKQAGEQGIKVIAYDRLIRNS 121 +Q AD Q+SQIEN++++GV V+VI + T L++ +K+A + GIKV++YDRLI N+ Sbjct: 66 VQSADASEQRQISQIENLISRGVDVIVIVPFNATVLTNTIKEAKKAGIKVLSYDRLILNA 125 Query: 122 GDVSYYATFDNFQVGVLQATSITDKLGLKDGKGPFNIELFGGSPDDNNAFFFYDGAMSVL 181 DV Y +FDN +VG +QA G+ K N L GGSP DNNA F +G M L Sbjct: 126 -DVDAYISFDNEKVGEMQAE------GILKVKNKGNFFLLGGSPTDNNAKMFREGQMKAL 178 Query: 182 KPYIDSGKLVVKSGQMGMDKVGTLRWDPATAQARMDNLLSAYYTDAKVDAVLSPYDGLSI 241 KPYID G + + Q W+P A + ++N L+A + K+DA+++ DG + Sbjct: 179 KPYIDKGDIKIVGQQW------VKEWNPTEALSIVENALTA--NNNKIDAIVASNDGTAG 230 Query: 242 GIISSLKGVGYGTKDQPLPVVSGQDAEVPSVKSIIAGEQYSTIFKDTRELAKVTVNMVNA 301 G I +L K +P VSGQDA++ +VK ++AG Q T++K +++A + Sbjct: 231 GAIQALAAQKLAGK---VP-VSGQDADLAAVKRVVAGTQTMTVYKPLKQIATEAAKLSVE 286 Query: 302 VMEGKEPEVNDTKTYENGVKVVPSYLLKPVAVTKENYKQVLVDGGYYKEDQL 353 + ++P N Y+NG K V S LLKP+ +TKEN K VLVD G+Y + Q+ Sbjct: 287 LARNEKPTYN--AQYDNGFKKVDSLLLKPILLTKENVK-VLVDDGFYTQAQI 335 Lambda K H 0.314 0.133 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 354 Length of database: 338 Length adjustment: 29 Effective length of query: 325 Effective length of database: 309 Effective search space: 100425 Effective search space used: 100425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory