Align Glyoxylate reductase; EC 1.1.1.26 (uncharacterized)
to candidate HSERO_RS07550 HSERO_RS07550 bifunctional glyoxylate/hydroxypyruvate reductase B
Query= curated2:B1L765 (332 letters) >FitnessBrowser__HerbieS:HSERO_RS07550 Length = 319 Score = 269 bits (688), Expect = 6e-77 Identities = 148/314 (47%), Positives = 204/314 (64%), Gaps = 3/314 (0%) Query: 1 MKPRVFVTREIPERGLSKIEEHFELDLWKDEAPPSKKVIIERVKDCDALVSLLTDPIDAE 60 MKP V V +++PE + +++ F+L L+ ++ I + ++ PI Sbjct: 1 MKPHVVVYKKLPEHLVQRLQAEFDLTLFDRITDDNRADFIAALATAHGMIGASL-PITNA 59 Query: 61 VFEAAPKLRIVAQYAVGYDNIDVKEATKRGIYVTNTPGVLTETTADFAFALLMAAARRVV 120 + EAAP+L+IV+ +VG DN D+ +RG+ + +TPGVLTE TAD FAL++A+ARRVV Sbjct: 60 MLEAAPQLKIVSTISVGVDNFDLDYFRQRGLMLAHTPGVLTEATADTIFALILASARRVV 119 Query: 121 EADRYVREGKWKVAWHPMMMLGYDVYGRTLGIVGMGRIGAAVARRAK-GFGMRILYYDSI 179 E YV+ G+WK + G +V+G+TLG++GMGRIG+AVARRA GFGM ILY++ Sbjct: 120 ELAEYVKAGRWKGSIGEAQF-GVNVHGKTLGLIGMGRIGSAVARRAHHGFGMPILYHNRR 178 Query: 180 RREDFEKELGVEYVPLEKLLEESDFVSLHVPLTEETYHMIGEEQLRRMKRTAILVNTSRG 239 + E+ELG YV E LL ++DFV + +PLT +T M G + MKR+AI +N SRG Sbjct: 179 PDPEAERELGARYVSKEDLLAQADFVCVMLPLTPQTERMFGAPEFALMKRSAIFINASRG 238 Query: 240 KVVDQKALYKALKEGWIAGAGLDVFEQEPIPPDDPLLKLENVVLAPHAASASHETRSRMA 299 ++VD+ AL AL++ I GAGLDVFE EP+P PLLKL NVV PH SA+HETR MA Sbjct: 239 RIVDEAALIAALQDKTIHGAGLDVFEVEPLPLQSPLLKLPNVVALPHIGSATHETRLAMA 298 Query: 300 EMVAENLIAFKRGE 313 E+ NLIA RGE Sbjct: 299 ELAVTNLIAGLRGE 312 Lambda K H 0.319 0.137 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 319 Length adjustment: 28 Effective length of query: 304 Effective length of database: 291 Effective search space: 88464 Effective search space used: 88464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory