Align Glyoxylate reductase; EC 1.1.1.26 (characterized)
to candidate HSERO_RS19280 HSERO_RS19280 D-2-hydroxyacid dehydrogenase
Query= SwissProt::Q9C4M5 (331 letters) >FitnessBrowser__HerbieS:HSERO_RS19280 Length = 316 Score = 215 bits (547), Expect = 1e-60 Identities = 133/315 (42%), Positives = 181/315 (57%), Gaps = 15/315 (4%) Query: 2 KPKVFITRQIPENGIKMIEKFYEIE-LWKDPKAPPRGVLLEKVREVDALVTLVTDKVDKE 60 +P V I ++P++ + ++++ Y L P + L ++ + KV +E Sbjct: 6 RPHVLIVARLPQHLLDLLQQHYTCHNLILQPHSEAE--LAAIAPQIRGIAANGEAKVSRE 63 Query: 61 LLENAPKLKIIAQYAVGYDNIDIEEATKRGIYVTNTPGVLTDATADLAFALLLAVARRIV 120 + P L+I++ + VGYD +D+ A +RGI+VT+TP VL D ADLA AL+LA AR +V Sbjct: 64 FMARFPALEIVSVFGVGYDGVDVPAARERGIHVTHTPDVLNDDVADLAMALMLATARNVV 123 Query: 121 EADAFVRSGEWKKSEVGWHPLMFLGYGLKGKTLGIVGFGRIGQALAKRAKGFGMKIIYYS 180 AD F RSGEWKK P F + G LGIVG GRIGQA+AKRA F M+I Y++ Sbjct: 124 RADRFARSGEWKKG-----PFPFT-TKVSGARLGIVGLGRIGQAIAKRAAAFDMQISYHN 177 Query: 181 RTRKPEAEEEIGAEYVDFET-LLKESDFISLHVPLTKETYHMIGEKELKLMKPNAILINT 239 R+RK ++ YVD T L +E DF+ + P T ++ + L+ + P LIN Sbjct: 178 RSRK-----DVPYTYVDSITALAREVDFLVMITPGGAGTRALVNAEVLEALGPKGFLINV 232 Query: 240 SRGAVVDTNALIKALKEGWIAGAGLDVFEEEPYYNEELFKLKNVVLAPHIGSATHEAREG 299 +RG+VVD ALI ALK G IAGAGLDVF +EP EL L NVVL PH+ S T R Sbjct: 233 ARGSVVDEAALIAALKTGVIAGAGLDVFADEPNVPAELAALDNVVLTPHMASGTLVTRTA 292 Query: 300 MAELVAKNLIAFAKG 314 MA+L NL A G Sbjct: 293 MADLAFNNLQAHFSG 307 Lambda K H 0.317 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 316 Length adjustment: 28 Effective length of query: 303 Effective length of database: 288 Effective search space: 87264 Effective search space used: 87264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory