Align L-arabinose 1-dehydrogenase (EC 1.1.1.46) (characterized)
to candidate HSERO_RS22475 HSERO_RS22475 3-oxoacyl-ACP reductase
Query= reanno::HerbieS:HSERO_RS05210 (261 letters) >FitnessBrowser__HerbieS:HSERO_RS22475 Length = 263 Score = 232 bits (591), Expect = 7e-66 Identities = 120/251 (47%), Positives = 159/251 (63%), Gaps = 1/251 (0%) Query: 11 ASFPSLKGKRVFITGGGTGIGAAIVEAFAQQGAHVAFVDIATEASEALCNEVAAAGHPKP 70 A + SL GKRV ITGGG+GIGAA+VEAF QGA V F+DIA E S+AL + A P Sbjct: 12 ALYRSLAGKRVVITGGGSGIGAALVEAFVGQGAQVCFLDIAAEPSQALVASLKDAPIA-P 70 Query: 71 LFRHCDLRDIPAFQATIAELQAQLGDFDVLVNNAANDQRHKLEEVTLEYWNDRIAINQRP 130 F C+L ++ A +AT E++ +G D+L+NNAAND RHK +VT YW++R+A+N R Sbjct: 71 RFFPCNLMNLEALRATFTEIETVMGGVDILINNAANDDRHKTADVTPAYWDERLAVNLRH 130 Query: 131 SFFAVQSVVEGMKRRGGGSIINFSSISWHQSGGGFPVYTTAKASTLGLTRGLARDLGPHK 190 FF Q+V+ GM+ R G I+NF SISWH +Y TAKA G+T G+ARD G Sbjct: 131 QFFCAQAVLPGMRERKQGVILNFGSISWHLGLPDLTLYMTAKAGIEGMTHGMARDFGRDG 190 Query: 191 IRVNTVTPGWVMTERQIKLWLDEEGKKAIARNQCLQGDLLPWHLARMVLFLAADDSAMCT 250 +RVN + PG + T RQ LW E + I QCL + P +A + LFL++D A CT Sbjct: 191 VRVNAIIPGAIRTPRQTLLWHTPEEEAKILAAQCLPTRVDPHDVAALALFLSSDSGAKCT 250 Query: 251 AQEFIVDAGWV 261 +E+ VDAGW+ Sbjct: 251 GREYYVDAGWL 261 Lambda K H 0.321 0.134 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 263 Length adjustment: 25 Effective length of query: 236 Effective length of database: 238 Effective search space: 56168 Effective search space used: 56168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory