Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate HSERO_RS01355 HSERO_RS01355 sugar ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >FitnessBrowser__HerbieS:HSERO_RS01355 Length = 381 Score = 264 bits (674), Expect = 4e-75 Identities = 165/376 (43%), Positives = 213/376 (56%), Gaps = 26/376 (6%) Query: 1 MGQIQLTDLTKRFGDTVAV-DDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGD 59 M I L K +GD V ++ LDI + EF V +GPSGCGKST LR +AGLE TSGD Sbjct: 1 MASITLRAAQKAYGDAPPVIRNVDLDIGEHEFCVFLGPSGCGKSTLLRSIAGLEDLTSGD 60 Query: 60 IYIGGDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVA 119 ++IGG +N R +AMVFQ YAL+PHMTV +N+ FGL + AE +++V E A Sbjct: 61 LFIGGKRVNDVPSAQRSVAMVFQSYALFPHMTVYENMSFGLTLAK-LPKAEIEQKVREAA 119 Query: 120 ETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQN 179 L + +LL RKP ELSGGQ+QRVA+GRAIVR P VFL DEPLSNLDA LR++ R E+ Sbjct: 120 RILQLEELLQRKPKELSGGQRQRVAIGRAIVRRPGVFLFDEPLSNLDATLRSQTRIEIAR 179 Query: 180 LQDQL-AVTTVYVTHNQTEAMTMADRIAVMDD-------GELQQVASPFECYHEPNNLFV 231 L Q + VYVTH+Q EAMT+ADRI ++ G + QV +P E YH P N FV Sbjct: 180 LHRQFEQASVVYVTHDQVEAMTLADRIVLLHAGADTQRFGSIAQVGTPMELYHHPRNRFV 239 Query: 232 AEFIGEPMINL----VRGTRSESTFVGEHFS-YPLDEDVMESVDDRDDFVLGVRPEDIEV 286 A FIG P +N V G + V S L ++ +GVRPE +E+ Sbjct: 240 AGFIGSPRMNFLPAQVAGVQENGILVRLSGSEETLLVAAQGALQPGQMVTVGVRPEHMEI 299 Query: 287 ADAAPDDAALDDHDLQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDR 346 + + +V +VE G+Q +HL P A L A G +TRG+R Sbjct: 300 GSQG-------QYGIHREVVLVERLGEQTYVHLDEP----AGQPLVAKAAGDARITRGER 348 Query: 347 VTVTIPPDKIHLFDAE 362 V V I P +LFD + Sbjct: 349 VRVAIAPACAYLFDQD 364 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 381 Length adjustment: 30 Effective length of query: 353 Effective length of database: 351 Effective search space: 123903 Effective search space used: 123903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory