Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate HSERO_RS18940 HSERO_RS18940 sn-glycerol-3-phosphate ABC transporter ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__HerbieS:HSERO_RS18940 Length = 364 Score = 286 bits (733), Expect = 5e-82 Identities = 171/367 (46%), Positives = 221/367 (60%), Gaps = 19/367 (5%) Query: 1 MARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETV 60 MA + L V K Y G + + I +I DGEF+V+VGPSGCGKST LRM+AGLE + Sbjct: 1 MAAIHLKQVRKTY-GAGTKAVDVIHGIDAEIADGEFIVMVGPSGCGKSTLLRMVAGLEEI 59 Query: 61 TEGELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRV 120 + G++ + DRV+N + ++RDIAMVFQ+YALYPH +V NM++GL+ GL EI RV Sbjct: 60 SSGQIVIGDRVVNDLEPKERDIAMVFQNYALYPHMTVYQNMAYGLKIQ-GLSKSEIDARV 118 Query: 121 EETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRT 180 + +L + LL+R P QLSGGQ+QRVA+GRAIVR P VFL DEPLSNLDAKLR +MR Sbjct: 119 QRAAAILELGALLERTPRQLSGGQRQRVAMGRAIVRKPAVFLFDEPLSNLDAKLRVQMRL 178 Query: 181 ELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFI 240 E+Q+L L T++YVTHDQ EAMT+G R+ V++ G +Q+GTP + Y RP FVA FI Sbjct: 179 EIQKLHASLRTTSLYVTHDQVEAMTLGQRMIVMNRGVAEQIGTPAEVYARPATTFVASFI 238 Query: 241 GEPSMNLFDGSLSGDTFRGDGFDYPLSGAT-----RDQLGGASG--LTLGIRPED-VTVG 292 G P MNL G LS D G F+ A+ L GA+G LG+RPE + + Sbjct: 239 GSPPMNLLQGKLSAD---GASFEVSKGNASDILRLPQPLTGAAGQERILGVRPEHLLPIL 295 Query: 293 ERRSGQRTFDAEVVVVEPQGNENAVHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVSFPE 352 + + Q EV +VE G E VH R G +V G R SF Sbjct: 296 DGSAAQ--LSLEVELVEALGAELLVHARC----GGQALVLRCPANVQVRTGQRIGASFGA 349 Query: 353 DAIHLFD 359 +H FD Sbjct: 350 GDVHWFD 356 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 364 Length adjustment: 30 Effective length of query: 353 Effective length of database: 334 Effective search space: 117902 Effective search space used: 117902 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory