Align Xylose/arabinose import ATP-binding protein XacK; EC 7.5.2.13 (characterized, see rationale)
to candidate HSERO_RS22750 HSERO_RS22750 sugar ABC transporter ATP-binding protein
Query= uniprot:D4GP39 (383 letters) >FitnessBrowser__HerbieS:HSERO_RS22750 Length = 377 Score = 289 bits (739), Expect = 1e-82 Identities = 171/376 (45%), Positives = 225/376 (59%), Gaps = 20/376 (5%) Query: 1 MARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSGCGKSTTLRMMAGLETV 60 MA + + + K Y +G D++A ++LDI DGEF VLVGPSGCGKST LRM+ GLE + Sbjct: 1 MAHVNIKQLRKTY--DGRADVLA--GLNLDIRDGEFCVLVGPSGCGKSTLLRMLCGLEEI 56 Query: 61 TEGELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMSFGLEESTGLPDDEIRQRV 120 + GEL + +V+N + +R IAMVFQSYALYPH +V NM+FGL+ + G +I R+ Sbjct: 57 SGGELAIGGQVVNHLPPAERGIAMVFQSYALYPHMNVYKNMAFGLKVA-GNSKSDIDARI 115 Query: 121 EETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRT 180 +L I LL R P +LSGGQ+QRVA+GRAIVR P +FL DEPLSNLDA LR + R Sbjct: 116 RHAAAILKIDHLLQRLPRELSGGQRQRVAIGRAIVRQPRLFLFDEPLSNLDAALRVQTRL 175 Query: 181 ELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGELQQVGTPLDCYHRPNNLFVAGFI 240 E+ +L +L T VYVTHDQ EAMT+GD++ V+ +G +QQ GTPL+ Y +P NLFVAGFI Sbjct: 176 EIAKLHRQLAATIVYVTHDQVEAMTLGDKIVVMHEGRIQQAGTPLELYQQPQNLFVAGFI 235 Query: 241 GEPSMNLFDGSLSGDTFRGDGFDYPLSGATR-----DQLGGASG--LTLGIRPEDVTVGE 293 G P MN F G ++ G ++G R D LG G +TLG+R E + G Sbjct: 236 GSPKMNFFQGVVT--RCDDSGVQVEIAGGLRLLADVDPLGVTPGAAVTLGLRAEQIREG- 292 Query: 294 RRSGQRTFDAEVVVVEPQGNENAVHLRFVDGDEGTQFTATTTGQSRVEAGDRTTVSFPED 353 + V +VE G N + +V D G G V+ G +S Sbjct: 293 -LGDGQPLHGVVNLVEHLGEANFL---YVTLDGGHDIVVRGDGNRNVDIGQPIALSVHSH 348 Query: 354 AIHLFDGETGDALKNR 369 A HLFD + G AL+ R Sbjct: 349 AFHLFDAQ-GQALRRR 363 Lambda K H 0.316 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 476 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 377 Length adjustment: 30 Effective length of query: 353 Effective length of database: 347 Effective search space: 122491 Effective search space used: 122491 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory