Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate HSERO_RS05175 HSERO_RS05175 sugar ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__HerbieS:HSERO_RS05175 Length = 516 Score = 166 bits (421), Expect = 7e-46 Identities = 85/214 (39%), Positives = 142/214 (66%), Gaps = 1/214 (0%) Query: 4 LLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVF 63 +LE+ +HK+F VKAL V + + GEV L+G NGAGKSTLIK+++G H+PD G + Sbjct: 12 MLELSGIHKAFAGVKALTDVGLRLFPGEVHTLMGQNGAGKSTLIKVLTGVHEPDGGKIEL 71 Query: 64 EGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKIFLNKKKMMEESKK 123 +G+ + S +A++LGI T+YQ++ L P+L + NIF+ R T ++ K + +S++ Sbjct: 72 DGRAIAPASTLEAQALGISTVYQEVNLCPNLSVAENIFVGRYPTRFGRIDWKSVHTQSRQ 131 Query: 124 LLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVEARKVLEL 183 LL LQI I D+ + + +Q VA++RA+ SAK++++DEPT++L E +++ ++ Sbjct: 132 LLQQLQIDI-DVAAPLSSYPLAIQQMVAISRALSVSAKVLILDEPTSSLDEAEVQQLFKV 190 Query: 184 ARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRG 217 R L+++G+ +L +TH + Q YE++DRI VL G Sbjct: 191 LRRLREQGMAILFVTHFLDQTYEISDRITVLRNG 224 Score = 94.0 bits (232), Expect = 6e-24 Identities = 61/231 (26%), Positives = 117/231 (50%), Gaps = 5/231 (2%) Query: 12 KSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGDLVFEGKKVIFN 71 + FG L +++ +GEV L G G+G++ + +++ G + D G L EGK+V N Sbjct: 281 EGFGRRGVLAPQDLQLRRGEVFGLCGLLGSGRTEMARLLFGADRADCGQLRIEGKEVRLN 340 Query: 72 SPNDARSLGIETIYQDL---ALIPDLPIYYNIFLAREVTNKIF--LNKKKMMEESKKLLD 126 P DA + GI +D I +L + NI LA + +F L +K+ + + + Sbjct: 341 VPRDAIAAGIGFCSEDRKKEGAILELSVRENIILALQARQGLFRVLPRKRQNQIAADYVK 400 Query: 127 SLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVEARKVLELARN 186 L I+ D+ + LSGG +Q +AR + M+++DEPT + V +++++ Sbjct: 401 WLGIKTADLETPIGLLSGGNQQKALLARWLATDPGMLILDEPTRGIDVRAKQEIMDFVIA 460 Query: 187 LKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEEITEVM 237 + +KG+ +L I+ I + +DR+ VL + ++ E + + + +V+ Sbjct: 461 MCRKGMSILFISSEIPEVLRCSDRMLVLRDRRACGEYRRGELDEQSVLQVI 511 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 251 Length of database: 516 Length adjustment: 29 Effective length of query: 222 Effective length of database: 487 Effective search space: 108114 Effective search space used: 108114 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory