Align ABC transporter for L-Arginine, substrate-binding component (characterized)
to candidate HSERO_RS21615 HSERO_RS21615 ABC transporter substrate-binding protein
Query= reanno::WCS417:GFF4245 (261 letters) >FitnessBrowser__HerbieS:HSERO_RS21615 Length = 271 Score = 129 bits (324), Expect = 6e-35 Identities = 74/234 (31%), Positives = 122/234 (52%), Gaps = 5/234 (2%) Query: 18 QAFAEGKPLKIGIEAAYPPFASKAPDGSIVGFDYDIGNALCEEMKVKCTWVEQEFDGLIP 77 QA A + +G+E+AY PF+S+ +VGFD DI AL +++ ++ +V F+G Sbjct: 41 QAAAPARVYVVGVESAYAPFSSENEQKDVVGFDIDIMKALAKKIGIEVKFVPTPFEGFFN 100 Query: 78 ALKVRKIDAILSSMSITDDRKKSVDFTNRYYLTPARLVLKEGTAVSDSLDELKGKKIGVQ 137 L D ++S+++ITD+RKKSV F+ Y++ + L +++LK +G Q Sbjct: 101 FLAQGDRDLLISAITITDERKKSVAFSEPYFVATQTIALPAADTKVSKMEDLKPLTVGTQ 160 Query: 138 RGSIHDRFAKEVLAPKGATIVPYSSQNEIYLDVEAGRLDGTVADATLLQEGFLDTPAGKG 197 + D ++VL A I + S ++E+G +D VAD +++ + P K Sbjct: 161 SATSGDELVQQVLGKNSAKIKRFDSTPLALKELESGGVDAVVADEPVVKNYIANNPNSKL 220 Query: 198 YAFTGPAFTDAKYFGDGIGIAVRKGDKENLDRINAAIAAIRANGKYKEIEKKYF 251 T P+F Y GIAVRK D E L +IN +A ++A+G + I +YF Sbjct: 221 RTVTDPSFPKEDY-----GIAVRKDDPELLAKINKGLAEMKADGSFAAISAQYF 269 Lambda K H 0.317 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 271 Length adjustment: 25 Effective length of query: 236 Effective length of database: 246 Effective search space: 58056 Effective search space used: 58056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory