Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate HSERO_RS08280 HSERO_RS08280 leucine/isoleucine/valine transporter permease subunit
Query= uniprot:Q1MCU1 (463 letters) >FitnessBrowser__HerbieS:HSERO_RS08280 Length = 408 Score = 343 bits (879), Expect = 8e-99 Identities = 211/432 (48%), Positives = 272/432 (62%), Gaps = 40/432 (9%) Query: 17 RKGLTEALFAAVLSFGMFVLYVGLKTDQNISNELIIVQRWGLLAIFVAVAAIGRFAMVVF 76 + +T AL AVL+ + + + L+ +++ W + VAV A+ F + Sbjct: 6 KNAVTAALVTAVLTIPLLGMQLQLE-----GYRVVLNTHW--TPVLVAVLAVFLFQLA-- 56 Query: 77 IRPNIDRRKLSKAREGELDISTEKSFFHRHFLKIALIALLLYPMVVVAIKGPQGSLTYVD 136 +P + R S A + + R + I L+A L++P GS YVD Sbjct: 57 -KPVLSR---SSAGIKLPALPRMQPRQQRAAVMILLMAALVWPFF--------GSRGYVD 104 Query: 137 NFGIQILIYVMLAWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLSSYFGLSFWVLLPLSG 196 + LIYV+L GLNIVVG AGLLDLGYV FYAVGAY+YAL + YFGL+FW +PL+ Sbjct: 105 VMTLA-LIYVVLGLGLNIVVGFAGLLDLGYVGFYAVGAYTYALCNQYFGLTFWECVPLAA 163 Query: 197 IFAALWGVILGFPVLRLRGDYLAIVTLAFGEIIRLVLINWTDVTKGTFGISSIPKATLFG 256 +AL+G +LGFPVLRLRGDYLAIVTL FGEIIRL+L N T +T G G+S IPK T+FG Sbjct: 164 AASALFGFLLGFPVLRLRGDYLAIVTLGFGEIIRLLLNNMTSITGGPDGVSGIPKPTVFG 223 Query: 257 IPF---DATAGG--FAKLFHLPISSAYYKIFLFYLILALCMLTAYVTIRLRRMPIGRAWE 311 + T GG F +LF L + IFL++L L + + T +VT RL RMP+GRAWE Sbjct: 224 LVMARNPVTEGGTTFHQLFGLSYQGGHMVIFLYFLALLMVLFTYFVTSRLLRMPMGRAWE 283 Query: 312 ALREDEIACRSLGINTVTTKLTAFATGAMFAGFAGSFFAARQGFVSPESFVFLESAVILA 371 ALREDEIACRSLGIN KL+AF GA FAG AGSFFAARQG V+PESF F+ESA+ILA Sbjct: 284 ALREDEIACRSLGINPTKVKLSAFTLGAAFAGLAGSFFAARQGLVTPESFTFIESALILA 343 Query: 372 IVVLGGMGSLTGIAIAAIVMVGGTELLREMSFLKLIFGPDFTPELYRMLIFGLAMVVVML 431 IVVLGGMGS G+ +AAI++ EL R SF + YRMLIFGL MV++M+ Sbjct: 344 IVVLGGMGSQLGVILAAILLTVLPELAR--SFAE-----------YRMLIFGLVMVLMMM 390 Query: 432 FKPRGFVGSREP 443 ++P+G + + P Sbjct: 391 WRPQGLLPATRP 402 Lambda K H 0.330 0.145 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 595 Number of extensions: 38 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 463 Length of database: 408 Length adjustment: 32 Effective length of query: 431 Effective length of database: 376 Effective search space: 162056 Effective search space used: 162056 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory