Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate HSERO_RS14710 HSERO_RS14710 amino acid ABC transporter ATPase
Query= uniprot:Q1MCU3 (247 letters) >FitnessBrowser__HerbieS:HSERO_RS14710 Length = 243 Score = 223 bits (567), Expect = 4e-63 Identities = 118/237 (49%), Positives = 161/237 (67%), Gaps = 2/237 (0%) Query: 9 QPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSV 68 QP+LQV + YG+I A+ G+ + +N+GEI +L+GANGAGKST ++ I G +A+ G V Sbjct: 8 QPILQVEDLAVAYGHIEAVKGISLSLNEGEITALVGANGAGKSTSLLAISGLVKAQRGRV 67 Query: 69 VFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKH-FAEDVEKIF 127 + G+D+ +M H I + Q EGR +TV ENL +GA K A D+E ++ Sbjct: 68 LLHGQDLLQMSPHRIVESGVVQVAEGRATLTTLTVEENLGLGAYTRKDKDGVARDLEWVY 127 Query: 128 TLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIR 187 +LFP LK R A G LSGGEQQML+IGRALMA+PK+LLLDEPS+GLAPLI++ IF ++ Sbjct: 128 SLFPVLKNRAAGLAGNLSGGEQQMLAIGRALMAKPKVLLLDEPSMGLAPLIIQEIFRIVQ 187 Query: 188 KLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYLEG 244 ++N+ G+TV LVEQN ALR++ R YV+ GK+ + SG LL NP+V AYL G Sbjct: 188 EINKT-GMTVLLVEQNVRQALRIAQRGYVLETGKIVLEDSGANLLGNPKVVEAYLGG 243 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 243 Length adjustment: 24 Effective length of query: 223 Effective length of database: 219 Effective search space: 48837 Effective search space used: 48837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory