Align 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 (characterized)
to candidate HSERO_RS16670 HSERO_RS16670 acetylornithine aminotransferase
Query= SwissProt::P50457 (421 letters) >FitnessBrowser__HerbieS:HSERO_RS16670 Length = 400 Score = 149 bits (377), Expect = 1e-40 Identities = 120/397 (30%), Positives = 187/397 (47%), Gaps = 40/397 (10%) Query: 34 LKDVEGNEYIDFAAGIAVLNTGHRHPDLVAAVEQQLQQFTHTAYQIVPYESYVTLAEKIN 93 L D G Y+D+ G AV GH + A+ Q ++ + + E + LA+ + Sbjct: 30 LTDHNGKRYLDYLQGWAVNTLGHAPQCIADALAAQSKKLINPSPAFYN-EPSIELAKLLT 88 Query: 94 ALAPVSGQAKTAFFTTGAEAVENAVKIARAH---------TGRPGVIAFSGGFHGRTYMT 144 A + + F +G EA E A+K+AR + R +I F FHGRT T Sbjct: 89 ANSVFD---RVFFANSGGEANEGAIKLARKWGKKNPAADGSARFEIITFKHSFHGRTLAT 145 Query: 145 MALTGKVAPYKIGFGP-FPGSVYHVPYPSDLHGISTQDSLDAIERLFKSDIEAKQVAAII 203 M+ +GK + F P PG +P + + L++++ L + A++ Sbjct: 146 MSASGKDG-WDTMFAPQVPG------FPK-----AVLNDLESVKALI-----GEHTVAVM 188 Query: 204 FEPVQGEGGFNVAPKELVAAIRRLCDEHGIVMIADEVQSGFARTGKLFAMDHYADKPDLM 263 EPVQGEGG A KE + +R L E +++I DEVQSG RTG+LFA H +PD+M Sbjct: 189 LEPVQGEGGVIPASKEFMQGLRSLTKEKNLLLIVDEVQSGMGRTGQLFAYQHSGIEPDIM 248 Query: 264 TMAKSLAGGMPLSGVVGNANIMDAPAPGGLGGTYAGNPLAVAAAHAVLNIIDKESLCERA 323 T+AK + GG+PL+ ++ I A G GGTY GNPL A AV+ + K E Sbjct: 249 TLAKGIGGGVPLAALLAREEIACFEA-GEQGGTYNGNPLMTAVGVAVIKELLKPGFMESV 307 Query: 324 NQLGQRLKNTLIDAKESVPAIAAVRGLGSMIAVEFNDPQTGEPSAAIAQKIQQRALAQGL 383 + GQ L+ ++ E RG G + A++ G A+ ++ GL Sbjct: 308 RERGQYLRQRSLEISEKY-GFEGERGEGLLRALQLG-RDIGPQIVEAARNLE----PVGL 361 Query: 384 LLLTCGAYGNVIRFLYPLTIPDAQFDAAMKILQDALS 420 LL + N++RF+ L + + D +L++ L+ Sbjct: 362 LLNS--PRPNLLRFMPALNVTKEEIDQMFSMLEEVLA 396 Lambda K H 0.319 0.134 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 373 Number of extensions: 13 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 400 Length adjustment: 31 Effective length of query: 390 Effective length of database: 369 Effective search space: 143910 Effective search space used: 143910 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory