Align Gamma-glutamylputrescine oxidoreductase; Gamma-Glu-Put oxidase; Gamma-glutamylputrescine oxidase; EC 1.4.3.- (characterized)
to candidate HSERO_RS01275 HSERO_RS01275 FAD-dependent oxidoreductase
Query= SwissProt::P37906 (426 letters) >FitnessBrowser__HerbieS:HSERO_RS01275 Length = 425 Score = 195 bits (495), Expect = 3e-54 Identities = 136/406 (33%), Positives = 202/406 (49%), Gaps = 17/406 (4%) Query: 28 CDVCVVGGGYTGLSSALHLAEAGFDVVVLEASRIGFGASGRNGGQLVNSYSRDIDVIEKS 87 CDV VVGGG TG ++AL LA G VVV EA +G ASGRNGG N +++D + + Sbjct: 27 CDVVVVGGGITGSAAALALARKGARVVVCEADIVGGAASGRNGGMCNNGFAQDYATLSQR 86 Query: 88 YGMDTARMLGSMMFEGGEIIRERIKRYQIDCDY-RPGGLFVAMNDKQLATLEEQKENWER 146 G++ A L G + + ++ IDC + R G L +A + + L +E R Sbjct: 87 LGVEWANRLYRAFDAGVDTVERLVREESIDCSFARHGKLKLAAKPEHVDKLARSQELLAR 146 Query: 147 YGNKQLELLDANAIRREVASDRYTGALLDHSGGHIHPLNLAIGEADAIRLNGGRVYELSA 206 + + LL +R E+ SDRY G LL H +H G A A + G E + Sbjct: 147 HVDGDTRLLSRAQLRDELGSDRYHGGLLMHKSAGMHVGRYVRGLAQAAQRRGALYLERTP 206 Query: 207 VTQIQHTTPA-VVRTAKGQVTAKYVIVAGNAYLGDKVEP--ELAKRSMPCGTQVITTERL 263 V I+ VRT+ G + A V++A +V P + +R +P G +I TE L Sbjct: 207 VLGIEAKNGRYAVRTSAGVLHAGQVLLASGI---SQVGPFGWIRRRIVPVGAFLIVTEPL 263 Query: 264 SEDLARSLIPKNYCVEDCNYLLDYYRLTADNRLLYGGGVVYGARDPDDVER---LVVPKL 320 L + L+P D ++Y+R T D RLL+GG + A +P R ++ ++ Sbjct: 264 PGALLKQLLPTQRMYTDTKNFVNYFRATPDQRLLFGGRARFAASNPQSDARSGEILRAQM 323 Query: 321 LKTFPQLKGVKIDYRWTGNFLLTLSRMPQFGRLDTNIYYMQGYSGHGVTCTHLAGRLIAE 380 L+ FP L +IDY W G +T R+P+ G+ D +YY GYSGHG L G ++AE Sbjct: 324 LEVFPALAQTRIDYCWGGMVDMTTDRLPRAGQRD-GLYYSMGYSGHGTHMATLMGSMMAE 382 Query: 381 LLRGDAERFDAFANLPHYPFPG--GRTLRVPFTAMGAAYYSLRDRL 424 ++ G AE + + + PG G+ +PF A+Y L+DRL Sbjct: 383 IMDGHAE-LNPWKDFDWPAIPGHFGKPWFLPFV---GAWYRLKDRL 424 Lambda K H 0.320 0.138 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 475 Number of extensions: 25 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 426 Length of database: 425 Length adjustment: 32 Effective length of query: 394 Effective length of database: 393 Effective search space: 154842 Effective search space used: 154842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory