Align Arginase (EC 3.5.3.1) (characterized)
to candidate HSERO_RS00305 HSERO_RS00305 arginase
Query= reanno::acidovorax_3H11:Ac3H11_701 (368 letters) >FitnessBrowser__HerbieS:HSERO_RS00305 Length = 302 Score = 411 bits (1056), Expect = e-119 Identities = 206/300 (68%), Positives = 238/300 (79%), Gaps = 3/300 (1%) Query: 65 LIGAPTDIGAGARGASMGPEALRVAGLQAALELHGLQVFDRGNLGGPSNPWLPPVNGYRH 124 ++GAPTD+GA RGASM P ALRVA LQ L+ HGL V D G+L GP+NP PPV G RH Sbjct: 6 MMGAPTDVGASRRGASMAPAALRVAELQRGLQQHGLDVIDGGDLAGPANPQQPPVQGLRH 65 Query: 125 LPEVAQWNRLVYDAVYAELQLGHLPILLGGDHSLGLGSISAVARHCAESGKKLRVLWLDA 184 L +V QWN+ V++AV L G LP+L+GGDH+L +GSI+AVA HC GK+LRVLWLDA Sbjct: 66 LEQVVQWNQTVHEAVAQCLADGELPLLMGGDHALAVGSIAAVAAHCRSQGKELRVLWLDA 125 Query: 185 HADFNTSELTPSGNVHGMPVACLCGFGPAELTQLAAMPGGGPALRPEQIRQIGIRSVDAG 244 HAD NTS+ TP+GN+HGMPVACL G GPA LT A+ G PAL+P+QI Q+GIRSVD Sbjct: 126 HADANTSQSTPTGNIHGMPVACLLGVGPAALT---AIGGQTPALQPQQICQVGIRSVDRE 182 Query: 245 EKRFVHEQGLEVFDMRAIDEVGMRQVMERALAGMDAHTHLHVSFDVDFLDPDIAPGVGTT 304 EKR + E G+ VFDMR IDE GMRQ ME ALAG+ THLHVSFDVDFLD +APGVGT Sbjct: 183 EKRHLRELGVRVFDMRHIDEYGMRQTMEEALAGVGPQTHLHVSFDVDFLDAALAPGVGTA 242 Query: 305 VPGGPTYREAQLCMEMIADSGRLASLDIVELNPALDVRNKTAVLAVDLVESLFGKSTLMR 364 VPGGPTYREAQLCMEMIAD+G LASLD++ELNPA DVRN+TA L VDLVESLFGKSTL+R Sbjct: 243 VPGGPTYREAQLCMEMIADTGALASLDVMELNPACDVRNQTAELVVDLVESLFGKSTLIR 302 Lambda K H 0.319 0.137 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 368 Length of database: 302 Length adjustment: 28 Effective length of query: 340 Effective length of database: 274 Effective search space: 93160 Effective search space used: 93160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS00305 HSERO_RS00305 (arginase)
to HMM TIGR01229 (rocF: arginase (EC 3.5.3.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01229.hmm # target sequence database: /tmp/gapView.6563.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01229 [M=300] Accession: TIGR01229 Description: rocF_arginase: arginase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-91 290.3 0.0 1e-90 290.1 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS00305 HSERO_RS00305 arginase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS00305 HSERO_RS00305 arginase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 290.1 0.0 1e-90 1e-90 2 299 .. 6 299 .. 5 300 .. 0.95 Alignments for each domain: == domain 1 score: 290.1 bits; conditional E-value: 1e-90 TIGR01229 2 ivglpfseGqgkrGvdkGpkalreaglleklkdlekevedlgqvaaaklekesdreavkaersvlaak 69 ++g+p + G+++rG + p alr a l+ l++ + +v d g++a +++ + ++++++++v++++ lcl|FitnessBrowser__HerbieS:HSERO_RS00305 6 MMGAPTDVGASRRGASMAPAALRVAELQRGLQQHGLDVIDGGDLAGPANPQQPPVQGLRHLEQVVQWN 73 5799*****************************************888899999************** PP TIGR01229 70 eklaekvkkvveekrfplvLggdHsiaiGtvsgvakkakdk..klgvlwlDAHaDintletstSgnlH 135 +++ e+v++ +++++pl++ggdH++a+G++++va + + + +l vlwlDAHaD nt ++++ gn+H lcl|FitnessBrowser__HerbieS:HSERO_RS00305 74 QTVHEAVAQCLADGELPLLMGGDHALAVGSIAAVAAHCRSQgkELRVLWLDAHADANTSQSTPTGNIH 141 ************************************99876669************************ PP TIGR01229 136 GmPlafllgrlkkev.edleelkllkgkeispkklvyiGlRdvdegErkilkelgikvfsmkeidklG 202 GmP+a llg ++ + + + ++ ++p++++ +G+R+vd+ E++ l+elg++vf+m++id++G lcl|FitnessBrowser__HerbieS:HSERO_RS00305 142 GMPVACLLG-VGPAAlTAIGG---QTP-ALQPQQICQVGIRSVDREEKRHLRELGVRVFDMRHIDEYG 204 *********.66665244444...777.6*************************************** PP TIGR01229 203 iakvvektleslkaedpihlSlDvDglDpklapatGtpvrgGltfrEgklilelllesglltaldlvE 270 + + +e++l+ + +++ +h+S+DvD+lD lap++Gt v+gG t+rE++l +e+++++g l +ld++E lcl|FitnessBrowser__HerbieS:HSERO_RS00305 205 MRQTMEEALAGVGPQTHLHVSFDVDFLDAALAPGVGTAVPGGPTYREAQLCMEMIADTGALASLDVME 272 ******************************************************************** PP TIGR01229 271 vNPtldikeksetikaavelvesllgetl 299 +NP d +++t++ +v+lvesl+g++ lcl|FitnessBrowser__HerbieS:HSERO_RS00305 273 LNPACD--VRNQTAELVVDLVESLFGKST 299 ******..899***************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (300 nodes) Target sequences: 1 (302 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.22 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory