Align Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; EC 3.5.3.1; EC 3.5.3.11 (characterized)
to candidate HSERO_RS08555 HSERO_RS08555 agmatinase
Query= SwissProt::P46637 (342 letters) >FitnessBrowser__HerbieS:HSERO_RS08555 Length = 317 Score = 129 bits (323), Expect = 1e-34 Identities = 93/290 (32%), Positives = 145/290 (50%), Gaps = 30/290 (10%) Query: 61 AKASTSLLGVPLGHNSSFLQGPAFAPPRIR-EAIWCGSTNSATEEGKELKDPRVLTDVGD 119 A +GVPL +S G F P +IR E++ N AT D + D+GD Sbjct: 33 AGLDVGFVGVPLDIGTSNRSGTRFGPRQIRTESVLLRPYNMATRAAPF--DSLKVADLGD 90 Query: 120 VPVQEIRDCGVDDDRLMNVISESVKLVMEEEP------LRPLVLGGDHSISYPVVRAVSE 173 V + + +SV+++ E + + LGGDH+++ P++RA++ Sbjct: 91 VALNPYS------------LLDSVRMIEEAYDRIYATGCKTISLGGDHTLTLPILRALA- 137 Query: 174 KLGGPVDILHLDAHPDIYDCFEGNKYSHASSFARIMEGGYA--RRLLQVGIRSINQEGRE 231 + GPV ++H+DAH D+ D G K +H + F R E G +R++Q+G+R + Sbjct: 138 RYRGPVGLIHVDAHADVNDTMNGEKIAHGTPFRRAFEEGLLDPQRVVQIGLRGTGYHADD 197 Query: 232 ----QGKRFGVEQYEMRTFSKDRPMLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEP 287 + + F V Q E P++E ++ G VY++ D+D LDPAFAPG E Sbjct: 198 FDWCRAQGFRVVQAEECWHRSLAPLMEEVRAQMGDGPVYLTFDIDGLDPAFAPGTGTPEI 257 Query: 288 GGLSFRDVLNILHNLQA-DVVGADVVEFNPQRDTVDGMTAMVAAKLVREL 336 GGL+ + L I+ + D+V ADVVE +P D G TA+VAA L E+ Sbjct: 258 GGLTVQQGLEIIRGCKGLDIVSADVVEVSPPYDQA-GTTALVAANLAYEM 306 Lambda K H 0.318 0.137 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 317 Length adjustment: 28 Effective length of query: 314 Effective length of database: 289 Effective search space: 90746 Effective search space used: 90746 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory