Align agmatinase (EC 3.5.3.11) (characterized)
to candidate HSERO_RS08555 HSERO_RS08555 agmatinase
Query= BRENDA::W5PHZ9 (361 letters) >FitnessBrowser__HerbieS:HSERO_RS08555 Length = 317 Score = 394 bits (1012), Expect = e-114 Identities = 195/308 (63%), Positives = 231/308 (75%) Query: 52 QPPSSEFVARSVGICSMMRLPMQATPEGLDAALVGVPLDIGTSNRPGARFGPRRIREESV 111 QP + R GI +MMRLP P GLD VGVPLDIGTSNR G RFGPR+IR ESV Sbjct: 7 QPLGGNVMPRFGGIATMMRLPHVEDPAGLDVGFVGVPLDIGTSNRSGTRFGPRQIRTESV 66 Query: 112 MLRTANPSTGAVPFQFLKVADLGDVNVNLYNLQDSCRLIRADYQKIVAAGCVPLTLGGDH 171 +LR N +T A PF LKVADLGDV +N Y+L DS R+I Y +I A GC ++LGGDH Sbjct: 67 LLRPYNMATRAAPFDSLKVADLGDVALNPYSLLDSVRMIEEAYDRIYATGCKTISLGGDH 126 Query: 172 TITYPILQAIAEKHGPVGLVHVDAHMDTADKALGEKLYHGTPFRRCVDEGLLDCKRVVQI 231 T+T PIL+A+A GPVGL+HVDAH D D GEK+ HGTPFRR +EGLLD +RVVQI Sbjct: 127 TLTLPILRALARYRGPVGLIHVDAHADVNDTMNGEKIAHGTPFRRAFEEGLLDPQRVVQI 186 Query: 232 GIRGSSTTLDTYRYSRSQGFRVVLAEDCWLKSLVPLMGEVRQQMGGRPIYISFDIDGLDP 291 G+RG+ D + + R+QGFRVV AE+CW +SL PLM EVR QMG P+Y++FDIDGLDP Sbjct: 187 GLRGTGYHADDFDWCRAQGFRVVQAEECWHRSLAPLMEEVRAQMGDGPVYLTFDIDGLDP 246 Query: 292 AYAPGTGTPEIAGLTPSQALEIIRGCQGLNVVGCDLVEVSPPYDPSGNTALVAANLLFEM 351 A+APGTGTPEI GLT Q LEIIRGC+GL++V D+VEVSPPYD +G TALVAANL +EM Sbjct: 247 AFAPGTGTPEIGGLTVQQGLEIIRGCKGLDIVSADVVEVSPPYDQAGTTALVAANLAYEM 306 Query: 352 LCVLPKVT 359 LC+LP VT Sbjct: 307 LCILPGVT 314 Lambda K H 0.321 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 16 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 361 Length of database: 317 Length adjustment: 28 Effective length of query: 333 Effective length of database: 289 Effective search space: 96237 Effective search space used: 96237 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS08555 HSERO_RS08555 (agmatinase)
to HMM TIGR01230 (speB: agmatinase (EC 3.5.3.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01230.hmm # target sequence database: /tmp/gapView.21225.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01230 [M=275] Accession: TIGR01230 Description: agmatinase: agmatinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.8e-68 214.9 0.0 1.1e-67 214.6 0.0 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS08555 HSERO_RS08555 agmatinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS08555 HSERO_RS08555 agmatinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 214.6 0.0 1.1e-67 1.1e-67 17 274 .. 39 308 .. 23 309 .. 0.92 Alignments for each domain: == domain 1 score: 214.6 bits; conditional E-value: 1.1e-67 TIGR01230 17 ivgiPydattsyrpGsrhgpeaireastnLeayseeld.rdlallkvvDagdlplaaGdaremvekie 83 vg+P+d ts r G+r+gp +ir+ s+ L y+ ++ lkv+D+gd+ l + ++v +ie lcl|FitnessBrowser__HerbieS:HSERO_RS08555 39 FVGVPLDIGTSNRSGTRFGPRQIRTESVLLRPYNMATRaAPFDSLKVADLGDVALNPYSLLDSVRMIE 106 689******************************98877588**************9999999****** PP TIGR01230 84 evveelleegkfvvaiGGeHsitlpvirAvkkkfeklavvqfDAHtDlrdefegeklshacvmrrvle 151 e +++ + g + +++GG+H++tlp++rA ++ +++ ++++DAH+D+ d +gek+ h ++ rr++e lcl|FitnessBrowser__HerbieS:HSERO_RS08555 107 EAYDRIYATGCKTISLGGDHTLTLPILRALARYRGPVGLIHVDAHADVNDTMNGEKIAHGTPFRRAFE 174 ******************************************************************** PP TIGR01230 152 lg....lnvlqigiRsg..ikeeadlarennikvlk.relede.....iaevlakvldkpvyvtiDiD 207 g ++v+qig+R +++d+ r ++ +v++ e ++ ++ev a++ d pvy+t+DiD lcl|FitnessBrowser__HerbieS:HSERO_RS08555 175 EGlldpQRVVQIGLRGTgyHADDFDWCRAQGFRVVQaEECWHRslaplMEEVRAQMGDGPVYLTFDID 242 9988888********75235789*********9986444433344555999***************** PP TIGR01230 208 vlDPafaPGvgtpepgGltskellklfvlaekekkvvGlDvvEvaPvydssevtaltaaklalelll 274 +lDPafaPG+gtpe+gGlt +++l+ ++ k +v +DvvEv+P yd++ tal aa+la+e+l lcl|FitnessBrowser__HerbieS:HSERO_RS08555 243 GLDPAFAPGTGTPEIGGLTVQQGLE-IIRGCKGLDIVSADVVEVSPPYDQAGTTALVAANLAYEMLC 308 *************************.899************************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (275 nodes) Target sequences: 1 (317 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.82 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory