Align Glutaminase-asparaginase; L-ASNase/L-GLNase; L-asparagine/L-glutamine amidohydrolase; EC 3.5.1.38 (characterized)
to candidate HSERO_RS07255 HSERO_RS07255 glutaminase
Query= SwissProt::O68897 (362 letters) >lcl|FitnessBrowser__HerbieS:HSERO_RS07255 HSERO_RS07255 glutaminase Length = 356 Score = 438 bits (1127), Expect = e-128 Identities = 223/352 (63%), Positives = 273/352 (77%), Gaps = 5/352 (1%) Query: 11 GALALLLLFPVAAQAKEVETKTKLANVVILATGGTIAGAGASAANSATYQAAKVGIEQLI 70 GA+ +L L A A + + K NVV++ TGGTIAGAGAS+ N+A YQ+A V ++++I Sbjct: 10 GAVMILSL----ACAFSAQAQDKKPNVVVIGTGGTIAGAGASSVNTAAYQSAVVPVDKII 65 Query: 71 AGVPELSQIANVRGEQVMQIASESINNENLLQLGRRVAELADSKDVDGIVITHGTDTLEE 130 A VPE+S+IANVRGEQ+ QI SES N+E L++LG+RV+EL DVDGIVITHGTDT+EE Sbjct: 66 AAVPEISKIANVRGEQIFQIGSESFNDERLIKLGKRVSELLKQNDVDGIVITHGTDTIEE 125 Query: 131 TAYFLNLVEKTDKPIIVVGSMRPGTAMSADGMLNLYNAVAVAGSKDARGKGVLVTMNDEI 190 TAYFLNLV K+DKP++VVGSMRPGTA+ ADG LNLY+AV VAGSK+A GKG LV MNDEI Sbjct: 126 TAYFLNLVLKSDKPVVVVGSMRPGTALGADGALNLYDAVLVAGSKEAAGKGTLVVMNDEI 185 Query: 191 QSGRDVSKMINIKTEAFKSPWGPLGMVVEGKSYWFRLPAKRHTMDSEFDIKTIKSLPDVE 250 SGRDV+K K E F+SP+GPLG VVE K ++RLPA+ HT +EFDI I SLP V+ Sbjct: 186 HSGRDVTKSNTFKVETFRSPYGPLGYVVENKLSFYRLPARPHTTQTEFDIDKISSLPRVD 245 Query: 251 IAYGYGNVSDTAVKALAQAGAKAIIHAGTGNGSVSSKVVPALQELRKQGVQIIRSSHVNA 310 I Y YGNVS TA A AGAKAIIH GTGNGSV+ ++VP LQE+R +GVQ+IR+S + Sbjct: 246 IVYNYGNVSRTAYDAFVAAGAKAIIHDGTGNGSVAEQIVPVLQEVRSKGVQVIRASRTGS 305 Query: 311 GGFVLRNAEQPDDKYDWVVAHDLNPQKARILAMVALTKTQDSKELQRMFWEY 362 G V+RN EQPDDK+DWVV D N QKARILA +ALTKT D KELQ++ W+Y Sbjct: 306 -GVVIRNGEQPDDKFDWVVTDDQNAQKARILAELALTKTNDPKELQKIMWKY 356 Lambda K H 0.315 0.130 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 356 Length adjustment: 29 Effective length of query: 333 Effective length of database: 327 Effective search space: 108891 Effective search space used: 108891 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS07255 HSERO_RS07255 (glutaminase)
to HMM TIGR00520 (L-asparaginase, type II (EC 3.5.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00520.hmm # target sequence database: /tmp/gapView.23248.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00520 [M=352] Accession: TIGR00520 Description: asnASE_II: L-asparaginase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-128 412.1 2.5 9.5e-128 411.9 2.5 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS07255 HSERO_RS07255 glutaminase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS07255 HSERO_RS07255 glutaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 411.9 2.5 9.5e-128 9.5e-128 11 349 .. 16 353 .. 6 356 .] 0.96 Alignments for each domain: == domain 1 score: 411.9 bits; conditional E-value: 9.5e-128 TIGR00520 11 avvlkvsaakaksLPnikilatGGtiagkgqssastaeYkvgklgvedLieavPelkeianiegeqiv 78 + +sa+ + + Pn+ +++tGGtiag+g+ss +ta+Y++ ++ v+++i avPe+++ian++geqi lcl|FitnessBrowser__HerbieS:HSERO_RS07255 16 SLACAFSAQAQDKKPNVVVIGTGGTIAGAGASSVNTAAYQSAVVPVDKIIAAVPEISKIANVRGEQIF 83 45556777778899****************************************************** PP TIGR00520 79 nvgsqdlneevllklakrisealasddvdGivithGtDtleetayfldltvksdkPvvlvGamRpats 146 ++gs+++n+e l+kl kr+se l+++dvdGivithGtDt+eetayfl+l++ksdkPvv+vG+mRp t+ lcl|FitnessBrowser__HerbieS:HSERO_RS07255 84 QIGSESFNDERLIKLGKRVSELLKQNDVDGIVITHGTDTIEETAYFLNLVLKSDKPVVVVGSMRPGTA 151 ******************************************************************** PP TIGR00520 147 vsaDGplnLYnavsvaadeksagrGvlvvlndrilsarevtktnttsldtfkseeqGalGyiandkie 214 + aDG+lnLY+av va+++++ag+G+lvv+nd+i s+r+vtk nt +++tf+s +G lGy++++k++ lcl|FitnessBrowser__HerbieS:HSERO_RS07255 152 LGADGALNLYDAVLVAGSKEAAGKGTLVVMNDEIHSGRDVTKSNTFKVETFRSP-YGPLGYVVENKLS 218 *****************************************************9.************* PP TIGR00520 215 yerepvkkhtletefdvskldeplPkvdiiYayqnlpeelvkavvdagakGivlagvGnGslsaaalk 282 ++r p+++ht++tefd++k ++ lP+vdi+Y+y n++ + +a v agak i+ g+GnGs+ ++ + lcl|FitnessBrowser__HerbieS:HSERO_RS07255 219 FYRLPARPHTTQTEFDIDKISS-LPRVDIVYNYGNVSRTAYDAFVAAGAKAIIHDGTGNGSVAEQIVP 285 **********************.********************************************* PP TIGR00520 283 vleeaakesvvivrssRvadGvvtkdae.vddkealiasgtLnPqkaRvLLqLaLtktkdlekiqevf 349 vl+e+ ++v ++r+sR+ +Gvv ++ e +ddk + + + n qkaR+L LaLtkt+d++++q++ lcl|FitnessBrowser__HerbieS:HSERO_RS07255 286 VLQEVRSKGVQVIRASRTGSGVVIRNGEqPDDKFDWVVTDDQNAQKARILAELALTKTNDPKELQKIM 353 **********************9998652678899999999************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (352 nodes) Target sequences: 1 (356 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.87 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory