Align Glutaminase-asparaginase; L-ASNase/L-GLNase; L-asparagine/L-glutamine amidohydrolase; EC 3.5.1.38 (characterized)
to candidate HSERO_RS19635 HSERO_RS19635 L-asparaginase
Query= SwissProt::O68897 (362 letters) >FitnessBrowser__HerbieS:HSERO_RS19635 Length = 353 Score = 387 bits (995), Expect = e-112 Identities = 204/358 (56%), Positives = 263/358 (73%), Gaps = 8/358 (2%) Query: 6 KTFVPGALALLLLFPVAAQAKEVETKTKLANVVILATGGTIAGAGASAANSATYQAAKVG 65 K F P + L L+ AAQA+ L NVVILATGGTIAG GA+ + Y AAKVG Sbjct: 3 KIFQPFLVLLCLVAAAAAQAQN------LPNVVILATGGTIAGTGATTTTTVGYTAAKVG 56 Query: 66 IEQLIAGVPELSQIANVRGEQVMQIASESINNENLLQLGRRVAELADSKDVDGIVITHGT 125 ++ LIA VPEL ++ANVRGEQVMQIASE++NN+ L+LG+RV L DVDGIVITHGT Sbjct: 57 VDALIAAVPELKKVANVRGEQVMQIASENMNNDAWLKLGKRVNTLLAQSDVDGIVITHGT 116 Query: 126 DTLEETAYFLNLVEKTDKPIIVVGSMRPGTAMSADGMLNLYNAVAVAGSKDARGKGVLVT 185 DT+EETAYFL+LV K+ KP+++VG+MRP TA+SADG +NLYNAV +AGSK+A GKGVLVT Sbjct: 117 DTIEETAYFLDLVVKSKKPVVIVGAMRPSTAISADGPINLYNAVLLAGSKEAIGKGVLVT 176 Query: 186 MNDEIQSGRDVSKMINIKTEAFKSP-WGPLGMVVEGKSYWFRLPAKRHTMDSEFDIKTIK 244 +ND+I +GR+V+K + FK+P G LG + K Y++R +++T+D+ FDI + Sbjct: 177 LNDQINAGREVTKTNTSTLDTFKTPELGFLGYIQGSKPYFYRQSTRKNTVDTPFDIMNLD 236 Query: 245 SLPDVEIAYGYGNVSDTAVKALAQAGAKAIIHAGTGNGSVSSKVVPALQELRKQGVQIIR 304 LP V+I YGY N++ A+ A AGA+ IIHAG G+GS+++ VVP+L E RK+GV I+R Sbjct: 237 KLPQVDIVYGYANMNPIALNAFVAAGAQGIIHAGVGDGSLNNTVVPSLTEARKKGVVIVR 296 Query: 305 SSHVNAGGFVLRNAEQPDDKYDWVVAHDLNPQKARILAMVALTKTQDSKELQRMFWEY 362 SS V G V RN E DDK D+VV+ LN QKARIL M+ALTKT D+KE+Q+MFWEY Sbjct: 297 SSRVGQ-GIVARNGEADDDKLDFVVSDTLNAQKARILLMLALTKTTDTKEIQKMFWEY 353 Lambda K H 0.315 0.130 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 304 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 353 Length adjustment: 29 Effective length of query: 333 Effective length of database: 324 Effective search space: 107892 Effective search space used: 107892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 49 (23.5 bits)
Align candidate HSERO_RS19635 HSERO_RS19635 (L-asparaginase)
to HMM TIGR00520 (L-asparaginase, type II (EC 3.5.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00520.hmm # target sequence database: /tmp/gapView.31825.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00520 [M=352] Accession: TIGR00520 Description: asnASE_II: L-asparaginase, type II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.8e-147 476.1 5.7 3.2e-147 475.9 5.7 1.0 1 lcl|FitnessBrowser__HerbieS:HSERO_RS19635 HSERO_RS19635 L-asparaginase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__HerbieS:HSERO_RS19635 HSERO_RS19635 L-asparaginase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 475.9 5.7 3.2e-147 3.2e-147 9 352 .] 10 353 .] 2 353 .] 0.98 Alignments for each domain: == domain 1 score: 475.9 bits; conditional E-value: 3.2e-147 TIGR00520 9 laavvlkvsaakaksLPnikilatGGtiagkgqssastaeYkvgklgvedLieavPelkeianiegeq 76 + + ++ + aa+a++LPn+ ilatGGtiag+g+++++t +Y++ k+gv+ Li avPelk++an++geq lcl|FitnessBrowser__HerbieS:HSERO_RS19635 10 VLLCLVAAAAAQAQNLPNVVILATGGTIAGTGATTTTTVGYTAAKVGVDALIAAVPELKKVANVRGEQ 77 556677788999******************************************************** PP TIGR00520 77 ivnvgsqdlneevllklakrisealasddvdGivithGtDtleetayfldltvksdkPvvlvGamRpa 144 ++++ s+++n++ +lkl kr+++ la++dvdGivithGtDt+eetayfldl+vks+kPvv+vGamRp+ lcl|FitnessBrowser__HerbieS:HSERO_RS19635 78 VMQIASENMNNDAWLKLGKRVNTLLAQSDVDGIVITHGTDTIEETAYFLDLVVKSKKPVVIVGAMRPS 145 ******************************************************************** PP TIGR00520 145 tsvsaDGplnLYnavsvaadeksagrGvlvvlndrilsarevtktnttsldtfkseeqGalGyiandk 212 t++saDGp+nLYnav +a+++++ g+Gvlv+lnd+i +revtktnt++ldtfk+ e G+lGyi+ +k lcl|FitnessBrowser__HerbieS:HSERO_RS19635 146 TAISADGPINLYNAVLLAGSKEAIGKGVLVTLNDQINAGREVTKTNTSTLDTFKTPELGFLGYIQGSK 213 ******************************************************************** PP TIGR00520 213 ieyerepvkkhtletefdvskldeplPkvdiiYayqnlpeelvkavvdagakGivlagvGnGslsaaa 280 +++r+ ++k+t++t+fd+ +ld+ lP+vdi+Y+y+n+ + ++a v aga+Gi+ agvG+Gsl++++ lcl|FitnessBrowser__HerbieS:HSERO_RS19635 214 PYFYRQSTRKNTVDTPFDIMNLDK-LPQVDIVYGYANMNPIALNAFVAAGAQGIIHAGVGDGSLNNTV 280 ************************.******************************************* PP TIGR00520 281 lkvleeaakesvvivrssRvadGvvtkdaevddk.ealiasgtLnPqkaRvLLqLaLtktkdlekiqe 347 + l ea k++vvivrssRv +G+v+++ e dd +++ s+tLn qkaR+LL+LaLtkt d+++iq+ lcl|FitnessBrowser__HerbieS:HSERO_RS19635 281 VPSLTEARKKGVVIVRSSRVGQGIVARNGEADDDkLDFVVSDTLNAQKARILLMLALTKTTDTKEIQK 348 *****************************9998779******************************** PP TIGR00520 348 vfeey 352 +f ey lcl|FitnessBrowser__HerbieS:HSERO_RS19635 349 MFWEY 353 **887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (352 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.32 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory