Align AapQ, component of General L-amino acid porter; transports basic and acidic amino acids preferentially, but also transports aliphatic amino acids (catalyzes both uptake and efflux) (characterized)
to candidate HSERO_RS17565 HSERO_RS17565 glutamate/aspartate ABC transporter permease GltJ
Query= TCDB::Q52813 (400 letters) >FitnessBrowser__HerbieS:HSERO_RS17565 Length = 241 Score = 87.4 bits (215), Expect = 4e-22 Identities = 46/130 (35%), Positives = 73/130 (56%) Query: 268 EFMSLFLALSFYTASFIAEIVRGGIRGVPKGQSEAAGALGLHPSSVTRLVVVPQALRIII 327 +F+ L L +TA+ + E VR GI +P+GQ A ALGL V++P A+RI++ Sbjct: 106 QFVMAMLCLGMFTAARVCEQVRSGIESLPRGQKGAGLALGLTLGQTYLFVLLPMAMRIVL 165 Query: 328 PPLTSQYLNLTKNSSLAIAIGFSDLVAVGGTILNQSGQAIEIVCIWGIVYLSLSILTSLF 387 PPLTS++LN+ KNS++A IG +L A G +++ + Q E + Y+ ++I Sbjct: 166 PPLTSEFLNIFKNSAVASTIGLLELAAQGRQLVDYTAQPYEAFIAVTLAYMLINICVMSL 225 Query: 388 MNWFNAKMAL 397 M K +L Sbjct: 226 MRILERKTSL 235 Score = 52.8 bits (125), Expect = 1e-11 Identities = 27/78 (34%), Positives = 43/78 (55%) Query: 83 SSDSTYARALLVGILNTLLVAVTGIFTATIIGFLIGIGRLSRNWLIAKLCTVYVEVFRNI 142 S+ TY LL G+ T+ + ++ A ++G +GI R N ++ YVE+FRN+ Sbjct: 15 STGQTYLDWLLSGLGVTVALGLSAWILALVLGTFLGILRTLPNRALSGFAACYVELFRNV 74 Query: 143 PPLLVIFFWYLGVLSVLP 160 P L+ IF WY + +LP Sbjct: 75 PLLVQIFIWYFAMPELLP 92 Lambda K H 0.327 0.141 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 400 Length of database: 241 Length adjustment: 27 Effective length of query: 373 Effective length of database: 214 Effective search space: 79822 Effective search space used: 79822 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory