Align ATPase (characterized, see rationale)
to candidate HSERO_RS17555 HSERO_RS17555 arginine ABC transporter ATP-binding protein
Query= uniprot:Q31RN8 (261 letters) >FitnessBrowser__HerbieS:HSERO_RS17555 Length = 244 Score = 248 bits (632), Expect = 1e-70 Identities = 134/243 (55%), Positives = 169/243 (69%), Gaps = 3/243 (1%) Query: 21 MIYAEGVEKWYGNQFQALCGVSLTVQRGEVVVMMGPSGSGKSTFLRTLNALESHQRGEIW 80 MI + V K+YG+ F+ L + + +GEVVV+ GPSGSGKST ++T+NALE Q G I Sbjct: 1 MITLQDVSKYYGD-FKVLSACNAVIAKGEVVVVCGPSGSGKSTLIKTINALEPIQEGSIT 59 Query: 81 IEGHRLSHDRRDIATIRQEVGMVFQQFNLFPHLTVLQNLMLAPVQVRRWPVAQAEATARQ 140 I+G +++ ++ +R VGMVFQ F LFPHLT++QNL LA ++V +A + Sbjct: 60 IDGVKVNDRSTNLPRLRSRVGMVFQHFELFPHLTIIQNLTLAQIKVLGRKKDEAHQHGMK 119 Query: 141 LLERVRIAEQADKYPGQLSGGQQQRVAIARALAMQPRILLFDEPTSALDPEMVREVLDVM 200 LERV + A KYPGQLSGGQQQRVAIARALAM P +LFDEPTSALDPEMV EVLDVM Sbjct: 120 YLERVGLKAHAGKYPGQLSGGQQQRVAIARALAMDPICMLFDEPTSALDPEMVNEVLDVM 179 Query: 201 RDLASEGMTMLVATHEVGFAREVADRVVLMADGQIVEEAPPDRFFT--APQSDRAKQFLA 258 +LA EGMTM+ THE+GFAR VA RV+ M G IVE+ D FF S R++QFL+ Sbjct: 180 VELAQEGMTMVCVTHEMGFARMVAHRVIFMDQGSIVEDRSKDDFFAGGGDHSARSRQFLS 239 Query: 259 QIL 261 +IL Sbjct: 240 KIL 242 Lambda K H 0.321 0.134 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 244 Length adjustment: 24 Effective length of query: 237 Effective length of database: 220 Effective search space: 52140 Effective search space used: 52140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory